KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo1581Help
Entry
lmo1581           CDS       T00066                                 

Gene name
ackA
Definition
(RefSeq) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Pathway
lmo00430  Taurine and hypotaurine metabolism
lmo00620  Pyruvate metabolism
lmo00640  Propanoate metabolism
lmo00680  Methane metabolism
lmo01100  Metabolic pathways
lmo01120  Microbial metabolism in diverse environments
lmo01200  Carbon metabolism
Module
lmo_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:lmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    lmo1581 (ackA)
   00640 Propanoate metabolism
    lmo1581 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    lmo1581 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    lmo1581 (ackA)
Enzymes [BR:lmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     lmo1581 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-GeneID: 986937
NCBI-ProteinID: NP_465106
Pasteur: LMO01581
UniProt: Q8Y6V0
Position
complement(1623099..1624292)
Genome map
AA seq 397 aa AA seqDB search
MEKTIAINAGSSSLKFQLYDMPSERVITAGIVERIGLKDSIFTITVDGEKIKEIIDIPDH
EIAVQMLLEKLINHKVIGSYDEITGIGHRVVHGGERFPESVYIDDQVIKDIEALSELAPL
HNPANVTGIKAFRKILPDVVSVAVFDTAFHQTMPPASYLYSLPYSYYEDYGIRKYGFHGT
SHKYVSERAAELLGRPVEELRLLTCHLGNGASIAAIEGGKSMDTSMGFTPLAGVSMGTRS
GNIDPALIPFIMEKTGKTAEQVLDVLNKESGMLGVSGISSDLRDLEDEAAKGNDRAELAL
QVFVDRIHKYIGSYAARMNGVDAIIFTAGIGENSSYIREKVLRGLEFMGVYWDPALNQVR
GEERFLNYPHSPVKVIIIPTNEELMIARDVETIKNNR
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaacgattgcaattaacgccggaagttcttcactgaaattccaattatatgat
atgccatctgaacgtgttatcacagcagggattgtagaaagaattggtttgaaagattct
atttttacaattactgtagacggagaaaaaatcaaagaaattattgatattcctgaccat
gaaattgctgttcaaatgctacttgaaaaattaattaaccacaaagttatcggttcttac
gatgaaatcactggaattggtcaccgcgttgttcacggtggagaaagattccctgaatcc
gtttatattgatgaccaagtaattaaagatattgaagctctatctgaacttgcaccgctt
cataacccagcgaacgttactggtattaaagcattccgcaagattttaccagacgttgtt
tcagtggctgttttcgatacagctttccatcaaacaatgcctccagcaagttatctttac
agcctgccatacagctattatgaagactatggtatccgtaaatacggtttccacggtaca
agtcacaaatatgtatccgaacgcgctgcagaacttttaggacgtcctgtagaagaatta
cgtttactaacttgtcaccttggtaatggtgctagtatcgctgcaatcgaaggcggaaaa
tcaatggacacttccatgggattcacaccactagctggtgtttctatgggaactcgttct
ggtaacattgaccctgcgcttattcctttcatcatggaaaaaactggtaaaactgcagaa
caagtacttgatgtgttaaacaaagaatctggtatgcttggcgtatctggtatttcaagc
gaccttcgtgatttagaagatgaagcagcaaaaggaaacgaccgcgcggaacttgcactt
caagttttcgttgaccgtatccataaatacattggttcttatgcagctcgcatgaacggt
gtagatgccattatcttcacagctggtatcggtgaaaatagttcatacatccgtgaaaaa
gtacttcgtggacttgaattcatgggcgtatactgggatccagcacttaaccaagtgcgc
ggagaagaaagattccttaactacccacattccccagtaaaagttatcatcattcctaca
aacgaagaattaatgattgctcgtgatgtagaaacaattaaaaataatcgctaa

DBGET integrated database retrieval system