KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo1684Help
Entry
lmo1684           CDS       T00066                                 

Definition
(RefSeq) glycerate dehydrogenase
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh AdoHcyase_NAD NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 985633
NCBI-ProteinID: NP_465209
Pasteur: LMO01684
UniProt: Q8Y6K0
Position
complement(1748792..1749733)
Genome map
AA seq 313 aa AA seqDB search
MNILFTLEVPEYLQTLQAEKFPEDTFYYESNDHFANLAEIDIIVTYGSNITKAKIKQASN
LKLIMVFSAGVDSLPREIIQERKIKVANVRGIHAIPMGEFALSFMLAHVKKAAFFYQMQK
EKNWASEEPITELAGKTLVVAGTGAIGAKVAEFAQAFDMEIIGVNTTGHPAKPFSETYAM
TNIEKVAPLADFFVSVLPHTDETMGIYSLSFFEKMKNNAVFINIGRGSAVELNVLEKASK
DQLIAHFYLDVLSEEPLSEDNSLWQANNVTITPHVSGHSDKYLERSFEIWFENINHLKEN
TKLRNEIDLNKGY
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaacattttatttacattggaagttccagaatatttacagactttgcaagcagagaaa
tttccagaggatactttttattatgagagcaatgatcattttgccaatttagcggagata
gatatcatcgtcacatacggatctaacattaccaaagccaaaatcaaacaagcaagcaac
ttaaaattaatcatggttttttccgcgggagtagatagtttaccaagagaaataattcaa
gaaagaaaaattaaagttgctaatgtacgaggaatccatgcgataccaatgggtgaattc
gcgctatcttttatgttagcacacgtaaaaaaagctgctttcttttatcaaatgcaaaaa
gaaaaaaattgggcaagtgaagaaccaataacagaattagctggaaaaactttggtagta
gctggaacgggagccattggagcaaaagtggccgagttcgctcaagcatttgatatggaa
atcataggggtaaatacaacgggccaccccgcgaaaccatttagtgaaacatatgcaatg
acgaatatcgaaaaagttgctccattagcagatttttttgttagtgttttacctcataca
gatgaaacaatgggtatttattctttatcattttttgagaaaatgaaaaataatgcagtt
tttatcaatatagggcgaggaagtgctgtagagttaaatgtcttagagaaagcatcaaaa
gaccaattaatagctcatttttatttagatgttttatctgaagagccgctttccgaagac
aattccttatggcaagcaaataatgtaactattacaccacatgtatctggacattcggat
aaatatttagagcgcagctttgaaatttggtttgaaaatatcaatcacttgaaagaaaat
acaaaattaaggaacgaaattgatttaaataaaggatattaa

DBGET integrated database retrieval system