KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo2059
Entry
lmo2059           CDS       T00066                                 

Name
(RefSeq) potassium channel protein
  KO
K10716  voltage-gated potassium channel
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lmo02000]
    lmo2059
Transporters [BR:lmo02000]
 Other transporters
  Pores ion channels [TC:1]
   lmo2059
SSDB
Motif
Pfam: Ion_trans_2 Ion_trans
Other DBs
NCBI-GeneID: 988010
NCBI-ProteinID: NP_465583
Pasteur: LMO02059
UniProt: Q8Y5K1
Structure
PDB: 
4H33 4H37

Position
2141071..2141814
AA seq 247 aa
MDKTKRKMIYETFMLILILLSLALLPYRNNFTFILNWIIWVIFTLDYLVRLYRADNKWHY
VKTHPFQLIAIIPFYGGFRAARIVSFVHLLSITAMGRRYIVPIYSFFRSNGLNRFLMIFV
LLVIIIPVPMVFIEPEINNYPDALWWAIVTATTVGYGDIVPVTPIGRILASIMMLFGIAF
IGMITSTITNFFRAKKPTNSSTQRANKITQLISETPDLTKEEIAVVEQFLTLRKKELADE
NTKSDSE
NT seq 744 nt   +upstreamnt  +downstreamnt
ttggataaaacaaagagaaaaatgatttatgagacttttatgcttattctcatattactt
tcccttgccctattaccgtacagaaacaactttacatttattttaaattggattatttgg
gtgatttttacgcttgattatctggttcgactttaccgggctgataataaatggcattat
gtaaaaacgcatccgtttcaactcattgcgattattccattttatggtggatttagagcg
gctcggattgttagttttgttcatcttttaagtattaccgcgatgggaagacgctatatt
gtaccgatttatagctttttccgttctaatggtttaaatcgatttttaatgatttttgtt
ttacttgtgattataattcctgttccgatggtatttatcgaacccgaaataaacaattat
cctgatgcgctttggtgggcgattgtgactgcgacaacagttgggtacggggatattgtt
cctgtcacgccaattggacggattttggcatcgattatgatgctgttcgggatagcattt
atcgggatgattactagtacgataacaaactttttccgcgccaaaaagcctactaattct
agtacgcaaagagcgaataagattacccaattaatttcagaaacaccagacttaaccaaa
gaagaaattgctgtagtagagcaatttttgacactaaggaaaaaagaattagctgatgaa
aacacaaaaagtgatagcgaatga

DBGET integrated database retrieval system