KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo2221Help
Entry
lmo2221           CDS       T00066                                 

Definition
(RefSeq) hypothetical protein
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_27 AAA_23 SMC_N QRPTase_C EmrE SbcCD_C AAA_29
Motif
Other DBs
NCBI-GeneID: 984625
NCBI-ProteinID: NP_465745
Pasteur: LMO02221
UniProt: Q8Y555
Position
complement(2308741..2311464)
Genome map
AA seq 907 aa AA seqDB search
MRITSIDIIGYGKWSDAHFNNIANFQVFYGENEAGKSTIMAFIHSILFGFPTKQQSIPRM
EPKNGGPYGGRLTLEDTSFGKVIIERLKGKATGDVRIYYGDGQTAGEEKLPEIIGEIDRN
TYEAIFSFDIHGLQNIHQWKKKEFERYLLATGTTGSDALLKTAETLQKKLDSLYKPSGRN
PLINQQLKRVKEAQQAFQNAKKQNAQYEELINEKEQATARQAELQIEKTTKRVELDTLET
LGDLWPLYQEWKALSNKASQKKEATFPPDGIIRLEHLQLREKEWQNQLIQLEERKKNLIS
NNDYEHSAFFAKNEAEITYLIETYAAFGEREIQLKNLKQEINFHQVDSKQTFRVWTSELE
QTMARLKEKEQFHKEQQHEIQLKLKLTNDTEEKLQKKIDQIEMDMWDNRTFQQAKEKMQQ
KPKTFRTKTFVSFGVFAVALSLMIVFQSIWSVALVFVSALIVGYAIMTTWKALPTNNEQL
LVFLEQKKIRQEWQQLLNEMDIIASQIAELRATENKLNETIYQHTMELKQLFSDLGIKHN
PDANWAYELAVYKKNSEKAQLAMELISKLEPLAEKQEVYKARLANLELPGKYTDTEEKIT
FLRQGLLYYRNHLTENAKLAEKLEQVTMQLDLVKQDLLLIKKEKADLLASANAKNEEEFR
MAAIRVKEEQNWRERLVLIEAQLEPEKRIALNQYENQATIKEKELQLEETLRQIELEQEK
IHASLAAQNHAIHKLEEGGTFAVLMQEFYSEKSKLQQIAAEWTETKLALQILQDTMQRLQ
EGKLPKTLKLASEYFNHLTNGNYDKVYLQDNRLQVESKNVVPFFPEELSQATKEQLYLAI
RFALIDVIHKDFPLPIIIDDGFVHFDSARMGQMMQLLRKRKSENQVIFFTCHQETRKYFS
SEDIRML
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgagaataacatccattgatatcattggttatgggaaatggtccgatgctcattttaat
aacatcgccaattttcaagttttttatggtgaaaatgaagccggaaaatcaactattatg
gcttttatacatagtattttgtttggttttccaacgaaacaacaatcaataccacgcatg
gagccaaaaaacggtggaccatacggcggaagattaacgctagaagacacctcttttgga
aaagtcatcattgaacgtttaaaaggaaaagcaactggagatgttcgaatatattacggt
gatggtcaaactgctggagaagaaaaattgccagaaattattggcgaaattgatcgaaac
acctatgaggctatcttttcttttgatatacacggattacaaaatattcatcaatggaag
aagaaagagtttgaacgctatttgttagcgacaggaacaactggctcggatgcactttta
aaaacagcagaaacattacaaaaaaaactagatagtctttataaaccaagtgggcgaaat
ccattaatcaatcaacagcttaaaagagtaaaagaagcccaacaagcttttcaaaatgcc
aaaaagcaaaatgcgcaatatgaagaattaattaatgagaaagagcaagcgacagcaaga
caagcagagttgcaaatagaaaaaacaactaaacgagtagagttagatacattagaaaca
ttaggggatttgtggccattataccaagaatggaaagcactaagtaataaggcttcccaa
aaaaaggaagctacttttccgccagatggaattatacgattagaacacctacagctccga
gaaaaagaatggcaaaatcagcttattcaattggaagaacgtaaaaaaaatctaattagc
aacaatgattatgaacatagcgctttttttgccaaaaatgaagcagaaataacatattta
atcgaaacctatgcagcttttggagagcgagaaatccagttaaagaatttaaaacaagaa
attaattttcatcaagttgactcaaaacaaacatttagagtatggacgagcgaacttgaa
caaacaatggcccgtttaaaagaaaaagaacagttccacaaagagcaacaacatgaaatt
cagttaaaattaaaacttactaatgatacagaagaaaaactccaaaagaagattgatcaa
atagaaatggatatgtgggataatagaacattccaacaagcaaaagaaaaaatgcaacag
aagcctaaaacatttagaactaagacttttgtttcatttggcgtttttgctgtagcttta
tcactgatgattgttttccaatctatctggagtgtagcacttgtttttgtatctgcgctt
attgtgggttatgcaattatgactacatggaaagcacttccaacaaacaatgaacaactt
ttagtttttttagaacaaaagaaaataaggcaagaatggcaacagcttctcaacgaaatg
gacattattgcatcacaaatagctgaactaagagcaaccgagaataaactaaacgaaaca
atttatcaacatacaatggaattaaaacaacttttttctgatttaggaataaaacataat
cccgatgcaaattgggcatatgagcttgcggtttataaaaaaaatagtgaaaaagctcaa
cttgcaatggaacttatctcaaaactagaaccattagcagagaaacaagaagtatataaa
gcaagacttgcaaacttagaattgcctggaaaatatacggatacagaagaaaaaatcact
tttttacgacaaggcttgctctattatcggaaccacttaactgaaaatgcaaagcttgca
gaaaagttggaacaagtaacgatgcaactagacttagttaagcaagatttattgctcata
aagaaagaaaaagcagatttattagcgagtgctaatgcgaagaatgaagaagaatttcgt
atggctgcaattcgtgtaaaagaagaacagaattggcgagaacgattagttctaatagaa
gcccaacttgaaccagaaaagcgaatagctctaaatcaatatgaaaaccaagcaactatc
aaagaaaaagagctgcaattggaagaaacacttcgccaaatagaactagaacaagaaaaa
atccatgcctcactcgcggcacaaaaccacgcaatacacaaattagaagaaggcgggact
ttcgcggtattgatgcaagaattctattcggaaaagagcaaactacaacaaatagcagcc
gaatggacagaaacaaaactggcgcttcaaattttacaagatacaatgcaacggttacaa
gaaggaaaacttcctaaaacgttaaaattagcaagtgaatatttcaaccacttaactaat
ggtaactatgacaaagtatacttacaagataataggcttcaagtagaaagtaagaatgtt
gtaccattcttcccagaagagctaagccaagcaacaaaagaacaattatatttggctatt
cgttttgccttaattgatgtgattcataaagattttccactaccaatcattattgatgat
ggatttgtgcattttgattctgctaggatgggacaaatgatgcaactgctccgaaaaaga
aaaagtgaaaaccaagtcatttttttcacatgccatcaagaaactcgcaaatatttttcc
agtgaggacatacgcatgctataa

DBGET integrated database retrieval system