KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo2249Help
Entry
lmo2249           CDS       T00066                                 

Definition
(RefSeq) low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    lmo2249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-GeneID: 984840
NCBI-ProteinID: NP_465773
Pasteur: LMO02249
UniProt: Q8Y528
Position
2338420..2339418
Genome map
AA seq 332 aa AA seqDB search
MEGMFLITLVIVLAALAFDLINGFHDTANAIATSVSTKALKPRHAIILAAVMNFVGAISF
TGVAKTITKDIVNPFDLDHGELVILAALLSAIAWNLITWYFGIPSSSSHALIGSIAGAAI
ASAGFAAIEYSGFTKIIIGLLVSPVLAFVVGYTIYSLFKVFLKNLNLATTNRRFRMIQVG
TAALQSYTHGTNDAQKSMGIITMALIASGFQTTDDVQLWVQVSCAIAMAIGTSIGGWKII
KTVGGKIMKIKPVNGVAADLSSVIIIFGATFIHLPVSTTHVISSSILGVGTAHRVKGVKW
DTAQRMIITWVITLPISATIAALIFYVLRFIL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaatgtttctcatcaccctcgtcatcgtacttgccgcgctagcatttgaccta
atcaacgggtttcatgatacagctaacgcaattgcgactagtgtctctacaaaagcctta
aaaccacgacatgcgattatcctcgctgccgtaatgaactttgtgggtgctatatcattc
acaggggttgctaaaacaattacaaaagacattgttaacccatttgacttagatcacggg
gaacttgttattttagcagcattactttcagctattgcttggaatttaatcacttggtat
ttcggaattcctagtagttcctctcatgccttgattggttccatcgccggtgcagcaatt
gcatcagctggatttgcagcaattgaatacagcggatttactaaaatcatcattggttta
ttagtatcccctgtacttgctttcgtagtcggttacacgatatattcactcttcaaggtt
ttcttgaagaacttaaacttagccacgaccaatcggcgcttccggatgattcaagtcgga
actgccgcactacaatcttacacacacggaaccaatgatgcccaaaaatcaatggggatt
atcacaatggcattaattgctagtggtttccaaacaacggatgatgtgcaattatgggtt
caagtatcctgtgcgattgctatggcgattggtacgagtattggtggttggaaaatcatc
aaaactgtcggtggtaaaatcatgaaaatcaaaccagttaatggtgtagcagctgattta
agttccgttatcattatttttggtgccactttcattcatttaccagttagtacaacacac
gtaatcagctcttctatcctaggtgttggaacagctcaccgtgttaaaggtgtcaaatgg
gatactgctcagcgcatgattattacatgggttatcacacttcctatttccgcaacgatt
gcagcacttatcttctatgtgctaagattcattctttaa

DBGET integrated database retrieval system