KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo2401Help
Entry
lmo2401           CDS       T00066                                 

Definition
(RefSeq) hypothetical protein
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Pathway
lmo00627  Aminobenzoate degradation
lmo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    lmo2401
Enzymes [BR:lmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     lmo2401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase YscJ_FliF
Motif
Other DBs
NCBI-GeneID: 987498
NCBI-ProteinID: NP_465924
Pasteur: LMO02401
UniProt: Q8Y4N4
Position
complement(2474801..2475568)
Genome map
AA seq 255 aa AA seqDB search
MKNYKAYLIDLDGTMYRGAEVIPEAIIFIENLKRAGLPYLFVTNNSTKTPGQVAEHLTDM
GIQAVSDDVFTTSQATVQFMMEQKREKTVYVIGERGIKQELTDNGFEITSSNPAFVVVGL
DREVDYEKFSKAALAVRGGAMFISTNGDAAIPTERGLLPGNGSITSVVSVATETAPIFIG
KPESIIMEQALAKLGVHKDEAIMVGDNYETDIMAGINYGMDTLIVHTGFTSKEALLTKEI
QPTYAVTKLTDWEFN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaattataaagcgtatttaattgatttagatggcacgatgtatcgcggagcagaa
gttattcctgaggcgatcatttttatcgaaaacttaaaacgtgcggggcttccgtattta
tttgtaacaaacaattcaacaaaaacacctgggcaagtagcagaacatttaactgacatg
gggattcaagctgtaagtgacgatgtattcacgacgtcacaagcaaccgtgcaatttatg
atggaacaaaaacgcgaaaaaacggtttatgttattggtgaacgtggaataaaacaagaa
ctaacagataatggatttgaaataacttctagtaatccagcttttgttgtcgttgggctt
gaccgggaagtcgattatgagaaattttcaaaggcagctcttgcagttcgcggtggagcg
atgtttatttcgacgaatggcgatgcggcaattccgacagagcgcggtttgcttccggga
aatggttcgatcacatcagtcgtttccgtagccacagaaacagcaccaatatttattgga
aagcctgaatccattattatggagcaagcacttgcaaaactcggtgtccataaagatgaa
gcaatcatggtgggagacaactacgaaaccgatattatggcgggaatcaattacggcatg
gatacgttaatcgtacacactggctttacatcaaaagaagcattattaacaaaagaaatc
cagcctacatacgctgtaacaaaactaactgattgggaatttaactag

DBGET integrated database retrieval system