KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo2526Help
Entry
lmo2526           CDS       T00066                                 

Gene name
murA
Definition
(RefSeq) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Pathway
lmo00520  Amino sugar and nucleotide sugar metabolism
lmo00550  Peptidoglycan biosynthesis
lmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    lmo2526 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    lmo2526 (murA)
Enzymes [BR:lmo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     lmo2526 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:lmo01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   lmo2526 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase Sigma70_r1_1
Motif
Other DBs
NCBI-GeneID: 984514
NCBI-ProteinID: NP_466049
Pasteur: LMO02526
UniProt: Q8Y4C4
Structure
PDB: 

Position
complement(2603863..2605155)
Genome map
AA seq 430 aa AA seqDB search
MEKIIVRGGKQLNGSVKMEGAKNAVLPVIAATLLASKGTSVLKNVPNLSDVFTINEVLKY
LNADVSFVNDEVTVDATGEITSDAPFEYVRKMRASIVVMGPLLARTGSARVALPGGCAIG
SRPVDLHLKGFEAMGAVVKIENGYIEATAEKLVGAKVYLDFPSVGATQNIMMAATLAEGT
TVIENVAREPEIVDLANFLNQMGARVIGAGTEVIRIEGVKELTATEHSIIPDRIEAGTFM
IAAAITGGNVLIEDAVPEHISSLIAKLEEMGVQIIEEENGIRVIGPDKLKAVDVKTMPHP
GFPTDMQSQMMVIQMLSEGTSIMTETVFENRFMHVEEMRRMNADMKIEGHSVIISGPAKL
QGAEVAATDLRAAAALILAGLVADGYTQVTELKYLDRGYNNFHGKLQALGADVERVDDSK
VDVTNLASLF
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaattattgtacgcggtggaaaacagttaaatggttctgtgaaaatggaaggt
gccaaaaatgctgtattaccggtaatagctgctacattacttgcgagtaaaggtactagc
gtattaaaaaatgtcccaaacttgtctgatgtattcacaatcaatgaggttcttaaatat
ctaaatgcagatgtttcttttgtaaatgatgaagtaacagttgatgcgacaggagaaatt
acttctgatgcaccttttgagtacgttcgtaaaatgcgtgcttccattgttgtaatggga
ccacttttggcacgtactggttcagcgcgtgtagctttacctggtggatgtgcaattggt
tctagacctgttgatttacatttaaaaggctttgaagcaatgggcgcagtcgtgaaaatt
gaaaatggttatattgaagcaactgctgaaaaattagtaggtgctaaagtatacttagat
ttcccgagtgttggagcgacacaaaatattatgatggctgcgactcttgcagaaggtaca
acagtcattgaaaacgttgctcgtgaacctgaaattgttgacttggcaaacttccttaac
caaatgggtgctagagttatcggtgcaggaacagaagtaattagaattgaaggagttaag
gaattaactgcgactgaacattctattattccagaccgtattgaagcaggaacatttatg
attgctgcggcgattactggtggaaatgttttaattgaagatgcagttcctgaacatatt
agttcgttaattgctaaacttgaagaaatgggcgttcaaatcattgaagaagagaacggg
attcgtgtaattggccctgataaattaaaagctgtagatgttaaaacgatgccgcatcca
ggtttcccaacagatatgcaatcgcaaatgatggttattcaaatgctgagtgaaggcaca
agcatcatgactgaaactgtttttgagaatcgttttatgcatgtagaagaaatgcgcaga
atgaatgctgatatgaaaattgaaggacattctgttattatttctggtccagctaagtta
caaggagcagaagttgcagcgacagatttacgtgcagcagcagcgcttattcttgctggt
ttggttgcagatggctatacacaagtaactgagttgaaataccttgatcgaggctataat
aatttccacggaaaactacaagcgcttggtgctgatgtggaacgtgtagatgattccaaa
gtcgatgtaacaaacttagcgtctttattctaa

DBGET integrated database retrieval system