KEGG   Listeria monocytogenes EGD-e (serotype 1/2a): lmo2829Help
Entry
lmo2829           CDS       T00066                                 

Definition
(RefSeq) nitroreductase
  KO
K07078  uncharacterized protein
Organism
lmo  Listeria monocytogenes EGD-e (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    lmo2829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase
Motif
Other DBs
NCBI-GeneID: 986896
NCBI-ProteinID: NP_466351
Pasteur: LMO02829
UniProt: Q8Y3K6
Position
2916291..2916890
Genome map
AA seq 199 aa AA seqDB search
MTNTFLDSIKVRRSIYALDKNVSVEDSKIEEIIKDAVKYSPSSFNSQSSRAVILLGENHD
KLWSIVEDTLRAIVPAENFAATEEKVGSFRAGYGTVLFFEDTAVIEGLQENFALYADNFP
VWSEQSSGIAQHSVWVALANAGIGASLQHYNPLIDDAVKAEWNIPASWNLRAQMPFGNIV
QEAGEKEFIDDADRFRVFK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgactaatacatttttagattctattaaagttcgtcgttccatttatgcactagataaa
aacgtttccgtagaggattccaaaattgaagaaattattaaagacgctgttaaatatagc
ccatcttctttcaactcccaaagttctcgcgctgtcattcttttaggcgaaaatcatgat
aaactttggagtatcgtagaagatacattacgcgctatcgtacctgctgaaaactttgca
gctactgaagaaaaagttggttctttccgcgctggatacggaacagttcttttctttgaa
gatactgctgttatcgaaggcttacaagaaaacttcgctctatatgcagacaacttccct
gtatggtccgaacaatcttcaggtattgcacaacattctgtatgggttgctcttgcaaac
gctggtatcggtgcatctcttcaacattacaacccactaattgacgatgctgttaaagct
gaatggaatattcctgctagctggaacctacgtgcgcaaatgccgtttggtaacatcgtt
caagaagctggtgaaaaagaattcatcgatgacgctgatcgtttccgcgttttcaaataa

DBGET integrated database retrieval system