KEGG   Listeria monocytogenes ATCC 19117 (serotype 4d): LMOATCC19117_1423Help
Entry
LMOATCC19117_1423 CDS       T02239                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmoa  Listeria monocytogenes ATCC 19117 (serotype 4d)
Pathway
lmoa00071  Fatty acid degradation
lmoa00072  Synthesis and degradation of ketone bodies
lmoa00280  Valine, leucine and isoleucine degradation
lmoa00310  Lysine degradation
lmoa00362  Benzoate degradation
lmoa00380  Tryptophan metabolism
lmoa00620  Pyruvate metabolism
lmoa00630  Glyoxylate and dicarboxylate metabolism
lmoa00640  Propanoate metabolism
lmoa00650  Butanoate metabolism
lmoa00900  Terpenoid backbone biosynthesis
lmoa01100  Metabolic pathways
lmoa01110  Biosynthesis of secondary metabolites
lmoa01120  Microbial metabolism in diverse environments
lmoa01130  Biosynthesis of antibiotics
lmoa01200  Carbon metabolism
lmoa01212  Fatty acid metabolism
lmoa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmoa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMOATCC19117_1423
   00630 Glyoxylate and dicarboxylate metabolism
    LMOATCC19117_1423
   00640 Propanoate metabolism
    LMOATCC19117_1423
   00650 Butanoate metabolism
    LMOATCC19117_1423
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LMOATCC19117_1423
   00072 Synthesis and degradation of ketone bodies
    LMOATCC19117_1423
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMOATCC19117_1423
   00310 Lysine degradation
    LMOATCC19117_1423
   00380 Tryptophan metabolism
    LMOATCC19117_1423
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMOATCC19117_1423
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMOATCC19117_1423
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LMOATCC19117_1423
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmoa04147]
    LMOATCC19117_1423
Enzymes [BR:lmoa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMOATCC19117_1423
Exosome [BR:lmoa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMOATCC19117_1423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CBY70322
Position
complement(1435878..1437047)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEIDPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAANAQEKNLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALNKG
GYSIDDIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILEKA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaatttggtggtagt
ttgaaagacatcagtgcagtagaccttggcgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgggtggatcaagtgatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtttgtggatctggcttaaaatcggttatgcttggtaggcaa
gcaattcagctaggggaggctgacatcgtagccgttggtgggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagctggcgaagaaatcgatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgagtatcacatgggaattact
gcagaaaatgttgcagagaaattctccgtaaccagagaagaacaagatgaatttgcccat
aactcacaaatgaaggccgcgaatgcacaagaaaaaaacctttttgaagaggaaattatt
cctgtaaagcttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctactttgaaaagcgtattcaaagaaggtggaacggttacagcc
ggcaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaagttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaaacaaaggt
ggatattctatcgatgacattgatttattccatttaaacgaagcttttgcatcgcagtca
gttgcagtggctcgtgatttaaaaattccagaagagaaacttaatatttacggtggagca
attgcactaggccatccaattggagcttctggtgcacgcattattgcctcattgttaaat
gagttaaaacatgaaaataagcacatcggtgtcgcttccttgtgtgttggtggtggtatt
ggtattgcaattatccttgaaaaagcttga

DBGET integrated database retrieval system