KEGG   Listeria monocytogenes ATCC 19117 (serotype 4d): LMOATCC19117_1424Help
Entry
LMOATCC19117_1424 CDS       T02239                                 

Gene name
mvaS
Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
lmoa  Listeria monocytogenes ATCC 19117 (serotype 4d)
Pathway
lmoa00072  Synthesis and degradation of ketone bodies
lmoa00280  Valine, leucine and isoleucine degradation
lmoa00650  Butanoate metabolism
lmoa00900  Terpenoid backbone biosynthesis
lmoa01100  Metabolic pathways
lmoa01110  Biosynthesis of secondary metabolites
lmoa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lmoa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LMOATCC19117_1424 (mvaS)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    LMOATCC19117_1424 (mvaS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMOATCC19117_1424 (mvaS)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMOATCC19117_1424 (mvaS)
Enzymes [BR:lmoa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     LMOATCC19117_1424 (mvaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N Chal_sti_synt_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CBY70323
Position
1437197..1438363
Genome map
AA seq 388 aa AA seqDB search
MKIGIDKIGFYTPAFYVDMVELAEARNIDPNKFTIGIGQDKMAFAPITQDSVTMGANAAL
QILDEEDLKKIDLVILATESGIDESKAGAVYIHRLLGIQPFSRAIEIKEACYGATAGINL
AKDYVAKHPDSKVLVIGSDIARYGLATGGEATQGAGAVAMVIAADPRCITLEDDNVFYTE
DIMDFWRPVYSEYACVEGKYSTEQYIHFFQTIWEKYSAKFGKNLEDFAAICFHLPYTKMG
KKALDTIIETAPTEVQERLLENYRLSTLYSRNVGNIYTGSLYLSFISLLDNQADLQAEDK
IGFFSYGSGAVGEFFHGVLQPDYKKYIRKDEHAELLANRTKLAIPDYETKFKQQLPKDGS
TFEVDPASDPATIVLTGIQEHKRQYIKK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggaattgataaaataggtttttatactcctgcattttatgttgatatggta
gaacttgctgaagctagaaatattgatcctaacaagtttactattggtattggccaagat
aaaatggcttttgctccgattacgcaagattcagtaacaatgggcgcaaatgcagcttta
cagattttagatgaagaagatttgaaaaaaattgatttagttattttggcgacagaatca
ggaattgatgagtcaaaggctggcgcggtttatattcaccgtttgctaggtattcagccg
ttctctcgtgcaattgaaataaaagaagcttgctacggagccactgcaggaattaattta
gcgaaagattatgttgcgaaacatcctgatagtaaagtactggttatcggatcggatatt
gctcgttacggcttggcaactggcggcgaagcaactcaaggagctggagctgttgcgatg
gttattgctgctgatccacgttgtatcacacttgaagacgataatgtgttttatacagaa
gatattatggacttctggcgccctgtttactctgagtatgcatgtgtagaaggtaaatat
tcgacggagcagtacattcactttttccaaaccatttgggaaaagtattcagcaaaattt
ggcaagaacttagaagattttgcagctatttgtttccacttaccatatacaaaaatgggt
aaaaaagcgttagatactattattgaaacagctccaactgaggttcaagaaagattgcta
gaaaattatcgtctaagtacgctttatagccgcaatgtcggtaatatttacactggttcc
ctctatttaagctttatttccttgttagacaatcaagcagatttacaagcagaggataaa
attggcttctttagttacgggtctggtgctgttggcgagttcttccatggagtgctacaa
cctgactataaaaaatatatccgtaaagatgaacatgcggaattgttagcaaaccgtacg
aaacttgctattccagattatgaaacgaaattcaaacaacaattacctaaagatggttcg
acgtttgaagtggatcctgctagtgacccagcaaccattgtattaactggtattcaagag
cataaacgtcaatatattaaaaaataa

DBGET integrated database retrieval system