KEGG   Listeria monocytogenes ATCC 19117 (serotype 4d): LMOATCC19117_1564Help
Entry
LMOATCC19117_1564 CDS       T02239                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
lmoa  Listeria monocytogenes ATCC 19117 (serotype 4d)
Pathway
lmoa00860  Porphyrin and chlorophyll metabolism
lmoa01100  Metabolic pathways
lmoa01110  Biosynthesis of secondary metabolites
lmoa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmoa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMOATCC19117_1564 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lmoa01007]
    LMOATCC19117_1564 (hemL)
Enzymes [BR:lmoa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     LMOATCC19117_1564 (hemL)
Amino acid related enzymes [BR:lmoa01007]
 Aminotransferase (transaminase)
  Class III
   LMOATCC19117_1564 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: CBY70463
Position
complement(1581182..1582471)
Genome map
AA seq 429 aa AA seqDB search
MQNYSKSEKAFKEAKKVLPGGVNSPVRAFNSVDASPVFMDHGKGAYITDVDGNEYIDYVL
SWGPLILGHADPAVVNAITKAALKGTSFGTPTEIETELAKLVIERVPSIEIVRMVSSGTE
ATMSAIRLARGYTKREKILKFEGSYHGHGDSLLIKAGSGVATLGLPDSPGVTKGLAADTI
TVPYNDIEGAELAFQKYGEEIAAVIVEPVAGNMGVVPPIDGFLEGLRELTTKFGSLLIFD
EVMTGFRVDYYSAQGYYVVTPDLTCLGKVIGGGLPVGAYGGKKEIMEQIAPAGSIYQAGT
LSGNPLAMNAGFETVRQLTPQHYDVFRTLIKRMEEGLTEISARRQVPLSINKAGSMFGFF
FTDQKVINFDTAKTSNLEFFRNYYREMLGQGIFLPPSQFEGVFISTMHTEKEIDKTLEAF
DTTCKILRG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaactattcgaaatccgaaaaggcctttaaagaagccaaaaaagtcttacctggt
ggtgtaaatagccctgttcgagcattcaactctgtagatgcctcgccagtttttatggac
cacggaaaaggcgcttatattacagatgttgatggtaacgaatatattgattatgtgtta
tcttggggccctctaattttagggcacgctgatccagctgttgttaatgctattacaaaa
gcagctctgaaaggtaccagctttgggacgcctactgagattgaaactgaattagcaaaa
ttagtaattgaacgtgtgccatctattgaaattgttcgtatggtttcatcaggaacggaa
gcaacgatgagtgctattcgtttggctcgcggttatacaaaaagagaaaaaatcttgaaa
tttgaaggaagttatcacggacatggagattctttattaattaaagctggttcaggggta
gcgacactcggattaccggattctccaggagttactaaaggtcttgcggcagatacaata
acagtcccatacaatgatattgaaggagccgaactggccttccaaaaatatggagaagaa
atagcagcagtcatagttgaaccagtcgcgggcaatatgggtgttgttcctccaattgat
ggatttttagaaggacttcgagagcttactacaaaatttggctccttgctcatttttgat
gaagttatgaccggatttagagtagattactattctgctcaaggctattatgtggtaacg
cccgatcttacttgtttaggaaaagtgattggtggtggtttaccagttggtgcttatggt
ggaaagaaagaaattatggaacagattgctcctgctggttctatttatcaagcgggaact
ttatccggaaatccattagcaatgaatgctggctttgaaacagttcgccaactaacgccg
caacactatgatgttttccgcaccctaattaagcgaatggaagaaggacttacagagata
tctgctagaagacaagtcccgctctcgattaataaggctggttcgatgttcggctttttc
ttcactgatcaaaaagtgattaattttgatacagcaaaaacaagtaatctagaatttttc
cgaaattattaccgtgaaatgttaggtcaaggcattttcttaccaccgtctcagtttgag
ggtgtcttcatttctacgatgcacaccgagaaagaaattgataagaccttggaagcattt
gatacgacatgcaaaatacttcgcggctaa

DBGET integrated database retrieval system