KEGG   Listeria monocytogenes ATCC 19117 (serotype 4d): LMOATCC19117_1598Help
Entry
LMOATCC19117_1598 CDS       T02239                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
lmoa  Listeria monocytogenes ATCC 19117 (serotype 4d)
Pathway
lmoa00220  Arginine biosynthesis
lmoa01100  Metabolic pathways
lmoa01110  Biosynthesis of secondary metabolites
lmoa01130  Biosynthesis of antibiotics
lmoa01230  Biosynthesis of amino acids
Module
lmoa_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:lmoa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    LMOATCC19117_1598 (argF)
Enzymes [BR:lmoa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     LMOATCC19117_1598 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: CBY70497
Position
complement(1620653..1621603)
Genome map
AA seq 316 aa AA seqDB search
MTMYAKNNTAGKDMLSLLEWNKEELTDIIKLAVAMKTNPAHYSHILSGKILGMIFDKPST
RTRVSFEAGILQLGGQAIVMSSKELQIGRGEPIKDTAHVMSEYIDAIMIRTFSHEKVEEL
AYHAEIPIINGLTDLHHPCQALADLMTIYEWKDQLEGVKLAYIGDGNNVCHSLLLAGAMV
GIDIRLAMPKGYEVDETILAKAENLAKQSGGKIFVTEDPKLAVTDADFIYTDVWTSMGQE
DENAKRLADFGEKYQVNAELVSGAKPDYHFLHCLPAHREEEVTAEIIDGNHSVIYQQAGN
RLHAQKALLAAILEAK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgtatgcgaaaaataatacagctgggaaagatatgctcagtttgcttgaatgg
aataaagaagaattgacagatattattaaattagctgttgcaatgaaaacgaatccagct
cattatagtcatattttaagcgggaaaattttaggaatgatctttgacaagccttctact
agaacacgggtttcttttgaagccgggattctgcaattaggtggacaagcgatagtgatg
agttcaaaggaattgcaaatcgggcgtggtgaaccgattaaagatacggcgcatgtgatg
tcagaatatattgatgcaattatgattcggacatttagtcatgaaaaagtagaagaattg
gcgtatcatgcagaaattccaattattaatggcttaaccgacctgcatcatccatgtcag
gcgttagcggatttaatgactatttatgaatggaaagatcagttggaaggtgtcaaacta
gcttatattggtgatggtaacaatgtatgtcattcattgcttttagccggcgctatggtc
gggatagatattcgccttgcgatgccaaaagggtatgaggtcgacgaaacaattcttgca
aaggcagaaaatctggcgaagcaaagtggtggcaagattttcgttacagaagatccaaaa
cttgcagtgactgatgcggactttatttatacggatgtttggacaagtatggggcaagaa
gatgaaaatgcgaaacgtttggcggattttggcgaaaaatatcaagtaaatgcagaatta
gttagtggtgccaagcctgattaccacttcttacattgcttaccagcacatcgggaagaa
gaagtgacagctgaaatcattgatggcaatcactcggtcatttatcaacaagcgggaaat
cggcttcatgcacaaaaagcattactagcagccatcttggaagcaaaataa

DBGET integrated database retrieval system