KEGG   Listeria monocytogenes ATCC 19117: LMOATCC19117_2556Help
Entry
LMOATCC19117_2556 CDS       T02239                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lmoa  Listeria monocytogenes ATCC 19117
Pathway
lmoa00260  Glycine, serine and threonine metabolism
lmoa00750  Vitamin B6 metabolism
lmoa01100  Metabolic pathways
lmoa01110  Biosynthesis of secondary metabolites
lmoa01120  Microbial metabolism in diverse environments
lmoa01230  Biosynthesis of amino acids
Module
lmoa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lmoa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMOATCC19117_2556 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LMOATCC19117_2556 (thrC)
Enzymes [BR:lmoa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LMOATCC19117_2556 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 PK_C
Motif
Other DBs
NCBI-ProteinID: CBY71455
Position
complement(2637325..2638380)
Genome map
AA seq 351 aa AA seqDB search
MYKGLLEKYKEYLPVTDKTPMISLAEGNTPLIPLPNLSKELGVTLYGKYEGLNPTGSFKD
RGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEGKVALGKLAQAVM
YGADIISIQGNFDEALKSVRELAETEAVTLVNSVNPYRLEGQKTAAFEICEQLGSAPDVL
AIPVGNAGNISAYWKGFKEWNEAKASGLPRMHGFEAEGAAAIVQGKPIDNPETIATAIRI
GNPASWELAEAARDESGGYIHSVTDDEIVNAYKKIAAQDGVFIEPGSAASLAGVIQHVAN
GTIKKGETVVCVFTGNGLKDPDTAMSVHEIPISHVDDIEAMRTHLRSGVKA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggtttactagaaaaatataaagaatatctaccagtaactgataaaacacca
atgatctcacttgcggaaggaaatacaccacttattccattaccgaatttgtccaaagaa
ctgggtgttactttatacggaaaatatgaaggcttaaatccaaccggttcttttaaagac
cgtggaatggttatggctgttgctaaagcgaaagaagaaggtgccgaagcggttatttgt
gcatccactgggaatacttctgctgcggctgcggcatacgcaacacgtgcgggattaaaa
gcgtacattgttattccagaaggcaaagtcgctctaggaaaattagcgcaagcagttatg
tacggcgcagatattatctcaattcaaggtaattttgatgaagcgttaaaatcggttcgt
gaactggctgaaacagaagcagtaacgcttgtaaactcggtaaatccttatcgtttagaa
ggtcaaaaaacagctgcattcgaaatttgtgagcaattaggttctgctccagatgtcctt
gcaatcccagtaggtaatgccggaaacatttctgcctactggaaagggtttaaagagtgg
aatgaggccaaggcttctggacttccacggatgcatggttttgaagcggaaggtgcggct
gcgattgttcaaggtaaaccgattgataatccggaaacaattgcaacggcgattcgtatc
ggaaatccagctagttgggagcttgcagaagcagctcgcgatgaatctggcggatatatc
cattctgtaacagatgatgaaattgtaaatgcgtataaaaaaattgcagcacaagatggt
gtctttatcgagccaggttcagccgcttcattagctggtgtcatccaacatgtagcaaat
ggaacaattaaaaaaggcgaaacagtagtttgtgtctttactggaaacggcttgaaagat
ccggatactgcgatgagtgtgcatgaaattccaatttctcatgtggatgatatcgaagca
atgcgcacacatttacgttcaggagtgaaagcttaa

DBGET integrated database retrieval system