KEGG   Listeria monocytogenes N53-1 (serotype 1/2a): BN419_1019Help
Entry
BN419_1019        CDS       T02513                                 

Definition
(GenBank) Putative amidase C869.01
  KO
K01426  amidase [EC:3.5.1.4]
Organism
lmob  Listeria monocytogenes N53-1 (serotype 1/2a)
Pathway
lmob00330  Arginine and proline metabolism
lmob00360  Phenylalanine metabolism
lmob00380  Tryptophan metabolism
lmob00627  Aminobenzoate degradation
lmob00643  Styrene degradation
lmob01100  Metabolic pathways
lmob01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmob00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BN419_1019
   00360 Phenylalanine metabolism
    BN419_1019
   00380 Tryptophan metabolism
    BN419_1019
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BN419_1019
   00643 Styrene degradation
    BN419_1019
Enzymes [BR:lmob01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BN419_1019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase S1FA
Motif
Other DBs
NCBI-ProteinID: CCQ23368
Position
complement(819956..821806)
Genome map
AA seq 616 aa AA seqDB search
MKKRILITIIVVCTVFSIIGGYVFFTSQKNTTSENKSAVSKNKKPIVKKEKPKQSSNNLT
LGKNKEDFHLEKGFDNMQLQVERIIDRIFQSSLKNRTEIKVKPKNNPQKKQNIKPVKPIP
SKPEKPEDSPSPFYDKARVMTPINNQLATLDLTVLEAKEPLIIGADVTKLQQLIATKQLS
YKELAGIYLNRIKKYDQNGLNLNAITEINPTIIAEAEQLDKENTTNKSALYGMPVLLKDN
IGTKELPTSAGTVALKDWVIGKDATIVENLKENGALILGKTNMSEWAAGMDEDLPNGYSG
KKGQSKNPYSANLDPSGSSSGSATAATSDFAAIAIGTETNGSIITPASAQSAVGYKPSQG
LVNNKGIIPLSSRFDTPGPLTRTVNDAYLTANALTNTTSNPSLSTDALKGKRIGLLADGE
SNEETAVIKKIKLDLQKAGATIIEGIAVGEFEQKESYDYASLINTDFKHDLNQFLQVNHS
PMSTLESIIQFNQTNPTRNMKYGQAELVKAQQSTITKQQADNLASNLIQSSQNELDSVLQ
KDKLDAVVTIGMGGSVMFLAPIAGNPELTIPAGYDEESNQPISLTFITARNSDKILLNMG
YAYEQQSQNRKSPNLK
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgcattttaataacaattatcgtagtttgtacagtcttcagtatcatcggt
ggctacgtattctttactagccaaaaaaatactacatcagaaaataaaagtgccgtttct
aaaaataaaaaacccatcgtaaagaaagaaaaaccaaaacaatcatcaaacaatttaaca
cttggcaaaaataaagaggactttcatttagaaaagggcttcgacaatatgcaattacaa
gtagaacgtataattgaccgtatttttcaaagttcgctcaaaaatagaactgagattaaa
gtcaaaccgaaaaataacccacaaaaaaaacagaacattaaacctgtaaaaccaatacca
agtaaaccggaaaagccagaagattcacctagtcccttttatgataaagcgcgtgttatg
acaccgattaataaccaattagctacgctagatttgactgttcttgaagcaaaagaacca
cttatcatcggtgctgatgttacaaaactccagcaacttattgcgacaaaacaacttagc
tacaaagaattagccggtatttatttaaaccgaataaaaaaatatgaccaaaatggccta
aatttaaatgcaataactgaaatcaatccaactattattgccgaagcagaacaactggat
aaagaaaacacaaccaacaaatctgctttatacggtatgccggtccttttaaaagataac
attggtacgaaagaacttcctacgagcgctgggaccgtagccttgaaagattgggtaatc
gggaaagatgctacaattgttgaaaatctaaaggaaaatggcgctttaatcctcggaaaa
actaatatgtccgagtgggcggctggaatggacgaagatcttccaaatggctattcaggt
aaaaaaggacaaagtaagaatccttactcggcgaatttagatccatctggttcaagttct
ggctctgccacagcagccacaagtgattttgcagcaattgcaatcggcacagaaacaaat
ggttctattattacgcctgcttctgctcaatcggctgttggatataagccatcccaaggt
ttagtaaataacaaaggcataattcctctatcaagcagatttgatacacctggaccgcta
acaagaaccgttaatgatgcctatttgacagcaaacgctttaacaaacactacttcaaat
ccatctctttctacggacgcccttaaaggtaaacgtatcggtcttttggcagatggagag
agtaatgaagaaacagctgttataaagaaaataaaacttgatctgcaaaaagctggcgct
actatcattgaaggcattgcagtgggcgaatttgaacagaaagaatcttatgattatgcc
tcattaataaatactgactttaaacatgatttaaaccagtttttgcaagtgaaccattct
cctatgtcgactttggaatcgattattcaatttaatcaaacgaatcctacaagaaatatg
aaatacgggcaagccgaacttgtcaaagcacagcaaagcacaataacgaaacaacaagcg
gacaatttggcgagtaatttgattcagagctcacaaaacgaacttgactctgtgcttcaa
aaagacaaactggatgctgtcgtaacaattggtatgggaggttcggtgatgtttcttgcg
ccaattgcggggaatccggaactgactatcccagctggctatgatgaagaatcaaatcag
ccaattagcctgacttttattactgccagaaatagcgataaaatcttattaaatatgggt
tatgcctatgagcaacaatcgcaaaatagaaaaagtcctaacttaaagtaa

DBGET integrated database retrieval system