KEGG   Listeria monocytogenes N53-1: BN419_1408Help
Entry
BN419_1408        CDS       T02513                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
lmob  Listeria monocytogenes N53-1
Pathway
lmob00860  Porphyrin and chlorophyll metabolism
lmob01100  Metabolic pathways
lmob01110  Biosynthesis of secondary metabolites
lmob01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmob00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN419_1408
Enzymes [BR:lmob01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BN419_1408
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BN419_1408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-ProteinID: CCQ23737
Position
1124022..1125503
Genome map
AA seq 493 aa AA seqDB search
MGKVMLIGAGPGDAQLLTVKGLAALQKADVIVYDRLVEPAMLQERKASCKLIYVGKEPLH
HPIPQDEIERILVREAATNELVVRLKAGDPYVFGRGGEEGETLHKAGIPFEVIPGITSAI
GGLAYAGIPVTHRDFASSFHVITGHLKKGRDPLDWEALARLEGTLVFLMGMTNLPNICAN
LLEHGQKPETGVAIVQWATRGKQLTVTGNLQTIEQKVAESGISSPALIVVGDVVSLRPQL
NFFEETPLFHTKVLLPRARAGKSMLAEQIRDLGGEVTMYPNIQVLDVAPTKTKEQLSEVS
ELLFTSKEAVERFFDYLAKLDLDIRSLKNSHLTAIGKQTKEAFSEKGIIPDSFIKRRSTE
LILEHLPRLQKNVSNLIIGSVVDTTEVNVILADVKTIEMMPLYDMRPVTERPFDLESFEQ
VCFSSSRSVQNLLDVLTIEEKAILQTKTILSIGRFTSATLASFGMNNFIEAESATPESLI
ELIQKTKLEGVPQ
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagttatgttaattggtgcagggcctggggatgcgcaactactgacagtgaaa
ggtttagctgcactacaaaaggcagatgttattgtttacgatcgcctcgtcgaaccagcg
atgctccaagaacgaaaagctagttgtaaactaatttatgttggaaaagaaccacttcat
catccaattccacaagatgaaatcgaacgaattcttgtaagagaagcggcaacgaatgag
cttgtcgtccgtttaaaagcaggtgatccttatgtatttggacgaggtggcgaagaagga
gagacactccataaagcaggaattccgtttgaagttatccctggaatcacttcagctatt
ggtgggctcgcctatgctggaatccctgtaacacatcgtgattttgcttcaagttttcat
gtcattaccggacatttgaagaaagggcgcgatccactagattgggaagcacttgctaga
ctggaaggtacacttgttttcttaatggggatgactaatttacctaatatctgtgcgaat
ttattagaacacggtcaaaagccagaaactggtgttgcaattgtacaatgggcaactcga
ggcaaacaattaacagtaactggaaatttgcaaaccatcgaacaaaaagtagctgagtcg
ggtatttcctctccagcacttatcgttgttggcgatgtagttagcttacgaccacaactg
aacttttttgaggaaacgccactttttcataccaaagtattacttccaagagcacgagca
ggaaagagtatgctcgcggaacaaattcgtgatttaggcggagaagtaacaatgtaccca
aatattcaagtattagatgttgcgccaacgaaaacaaaagaacaactaagcgaagtaagc
gaactgcttttcacatcaaaagaagctgtagaacgattttttgattatttagccaagctt
gatttagatattcgttctcttaaaaatagccatctgacggctattggcaagcaaacgaag
gaagcatttagcgaaaaaggaattattccagatagttttattaaaagacggagcacggaa
ttgattttagagcatttaccacgattacagaaaaatgtgagtaatttaattatcggaagc
gtagttgatacgaccgaagttaatgttattttagctgatgtaaaaactattgaaatgatg
ccgttatatgatatgcgcccagtgacagaacgaccatttgatctcgaaagctttgaacaa
gtatgtttttcaagttcgcgttccgtccaaaatctacttgatgtactaacaatagaagaa
aaggcgattttacaaacgaaaacaatcctttcgattggaaggttcacgagcgcaacttta
gcgtcattcggtatgaacaatttcatagaagccgaaagcgccacaccagagagcttaatc
gaactaatccaaaaaacaaaattagaaggagtaccacaatga

DBGET integrated database retrieval system