KEGG   Listeria monocytogenes N53-1 (serotype 1/2a): BN419_1656Help
Entry
BN419_1656        CDS       T02513                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmob  Listeria monocytogenes N53-1 (serotype 1/2a)
Pathway
lmob00071  Fatty acid degradation
lmob00072  Synthesis and degradation of ketone bodies
lmob00280  Valine, leucine and isoleucine degradation
lmob00310  Lysine degradation
lmob00362  Benzoate degradation
lmob00380  Tryptophan metabolism
lmob00620  Pyruvate metabolism
lmob00630  Glyoxylate and dicarboxylate metabolism
lmob00640  Propanoate metabolism
lmob00650  Butanoate metabolism
lmob00900  Terpenoid backbone biosynthesis
lmob01100  Metabolic pathways
lmob01110  Biosynthesis of secondary metabolites
lmob01120  Microbial metabolism in diverse environments
lmob01130  Biosynthesis of antibiotics
lmob01200  Carbon metabolism
lmob01212  Fatty acid metabolism
lmob02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN419_1656
   00630 Glyoxylate and dicarboxylate metabolism
    BN419_1656
   00640 Propanoate metabolism
    BN419_1656
   00650 Butanoate metabolism
    BN419_1656
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN419_1656
   00072 Synthesis and degradation of ketone bodies
    BN419_1656
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN419_1656
   00310 Lysine degradation
    BN419_1656
   00380 Tryptophan metabolism
    BN419_1656
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN419_1656
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN419_1656
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN419_1656
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmob04147]
    BN419_1656
Enzymes [BR:lmob01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN419_1656
Exosome [BR:lmob04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN419_1656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCQ23975
Position
complement(1340075..1341244)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEINPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAASAQEKKLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDEIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaattcggtggtagt
ttgaaagacatcagtgcagtagatcttggtgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgtgtggatcaagtaatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtgtgtggatctggcttaaaatcggttatgcttggcagacaa
gcaattcaactaggggaagctgacatcgtagcagtaggagggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagccggtgaagaaatcaatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgaatatcacatgggaattact
gcagaaaatgttgcggaaaaattctccgtaacccgagaagaacaagatgaatttgctcat
aactctcaaatgaaggccgcaagtgcacaagaaaaaaaactttttgaagaagaaattatt
cctgtaaaacttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctacgttgaaaagcgtattcaaagaaggtggaactgttacagcc
ggtaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaggttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgaaattgatttattccatttaaacgaagcttttgcatcgcagtct
gttgcagtggctcgtgatttgaaaattcccgaagagaaacttaatatttacggtggagca
attgcgctaggtcatccaatcggagcttccggcgcacgcattattgcctctttgttaaat
gaattaaaacatgaaaacaagcatatcggggtagcttccttgtgcgttggtggtggtatt
ggcattgcaattatccttgaaagagcatga

DBGET integrated database retrieval system