KEGG   Listeria monocytogenes N53-1 (serotype 1/2a): BN419_1833Help
Entry
BN419_1833        CDS       T02513                                 

Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lmob  Listeria monocytogenes N53-1 (serotype 1/2a)
Pathway
lmob00020  Citrate cycle (TCA cycle)
lmob00480  Glutathione metabolism
lmob01100  Metabolic pathways
lmob01110  Biosynthesis of secondary metabolites
lmob01120  Microbial metabolism in diverse environments
lmob01130  Biosynthesis of antibiotics
lmob01200  Carbon metabolism
lmob01210  2-Oxocarboxylic acid metabolism
lmob01230  Biosynthesis of amino acids
Module
lmob_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lmob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN419_1833
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BN419_1833
Enzymes [BR:lmob01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BN419_1833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CCQ24150
Position
complement(1498612..1499874)
Genome map
AA seq 420 aa AA seqDB search
MSQKIQVENGVLKTPNNPVIPFIEGDGTGPDIWAAAKRVLDAAVKKAYNGEKEIAWKEVL
AGEKAFKQTGEWLPQATLDTIDEYLIAIKGPLTTPIGGGIRSLNVALRQELDLYVCLRPV
RYFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEFKEGSIESKKLIDFLKSEFGVDKIRFP
ETSGIGIKPISKEGTERLVRSAIEYAIKEGRKSLTLVHKGNIMKFTEGAFKNWGYDLCER
EYGDKVFTWNEYDRIKEAEGTEVADAKQNEALAAGKILVKDSIADIFLQQILTRPAEFDV
VATMNLNGDYISDALAAQVGGIGIAPGANINYLTGHAIFEATHGTAPKYAGLDKVNPSSV
ILSGTLLLEHIGWGEAAALINQSMEKTIAAKTVTYDFARLMDGATEVKCSEFADELIKNF
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaaattcaagtagaaaacggtgtgctaaaaacaccaaacaatccagtcatt
ccttttattgaaggggacggaactggtccagacatctgggcagctgcgaaacgcgtttta
gatgccgcagtaaaaaaagcttacaatggtgaaaaagaaattgcttggaaagaagtatta
gctggcgaaaaagcattcaagcaaacaggagaatggttaccacaggcgactttagataca
attgacgaatatttgattgctattaaaggaccacttactactccaatcgggggaggcatt
cgttcactaaacgttgccctgcgccaagagttagatttatatgtttgtttacgtccagtt
cgttatttcaaaggtgttccttcaccagtgaaacgtccagaagacacagatatggtcatt
ttccgtgagaatacagaagatatttatgcagggattgaatttaaagaaggtagcatagaa
tcgaaaaaactaatcgacttcttaaaatctgaatttggtgttgataaaatccgtttcccg
gaaacttctggaattggtatcaagccgatttccaaagaaggaacggagcgtttagtgcgt
tcggcgattgaatatgcaattaaagaaggtcgtaaatcattaacgctcgtacacaaaggg
aatatcatgaagttcacagaaggagctttcaaaaattggggctatgacttatgtgaacgc
gaatatggtgataaagtatttacttggaatgagtatgatcgaattaaagaagcagaagga
acagaagttgctgacgcgaaacaaaacgaagcgcttgctgctgggaaaattttagtcaaa
gattcgattgcggatattttcttgcaacaaatcttaactcgcccagctgaatttgatgta
gttgctacaatgaacttgaatggagactacatttccgatgcgcttgctgctcaagtaggc
ggaatcggtattgctccaggagcaaacattaactacttaactggtcatgcgattttcgaa
gcgacgcatggtactgctccgaaatatgccggtcttgataaagtaaatccgtcatcggtt
attttatctgggacacttctgcttgaacacattggttggggtgaagcggctgccttaatt
aatcaatcaatggaaaaaaccattgctgcgaaaacggtaacctatgattttgctcgatta
atggatggtgcgacagaagttaaatgttcggaatttgcggacgaattaataaaaaacttc
taa

DBGET integrated database retrieval system