KEGG   Listeria monocytogenes N53-1 (serotype 1/2a): BN419_1862Help
Entry
BN419_1862        CDS       T02513                                 

Definition
(GenBank) Ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
lmob  Listeria monocytogenes N53-1 (serotype 1/2a)
Pathway
lmob00220  Arginine biosynthesis
lmob01100  Metabolic pathways
lmob01110  Biosynthesis of secondary metabolites
lmob01130  Biosynthesis of antibiotics
lmob01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lmob00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BN419_1862
Enzymes [BR:lmob01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     BN419_1862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: CCQ24179
Position
complement(1522146..1523096)
Genome map
AA seq 316 aa AA seqDB search
MTMYAKNNTSGKDMLSLLEWNKEELTDIIKLAVAMKTNPAHYSHILSGKILGMIFDKPST
RTRVSFEAGILQLGGQAIVMSSKELQIGRGEPIKDTAYVMSEYIDAIMIRTFSHEKVEEL
AYHAEIPIINGLTDLHHPCQALADLMTIYEWKDQLEGIKLAYIGDGNNVCHSLLLAGAMV
GIDIRLAMPKGYEVDETILAKAENLAKQSGGKLFVTEDPKLAVTDADFIYTDVWTSMGQE
DENAKRLADFGEKYQVNAELVSGAKPDYHFLHCLPAHREEEVTTEIIDGIHSVIYQQAGN
RLHAQKALLAAILEAK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgtatgcaaaaaataatacatctgggaaagatatgctcagtttgcttgaatgg
aataaagaagaattgacggatattattaaattggctgttgcgatgaaaacgaacccagct
cattatagccatattttaagcgggaaaattttaggaatgatatttgataagccttctact
agaacgcgggtttcttttgaagcggggattctgcaattaggtgggcaagcgattgtgatg
agttcaaaggaattacaaattgggcgtggtgagccgattaaagacacggcgtatgtaatg
tcagaatacatcgatgcgattatgatccgaacatttagtcatgaaaaagtagaagaattg
gcgtatcatgcagaaattccaattattaatggcttaactgacttacatcatccatgtcag
gcgttagcggatttaatgactatttatgaatggaaagatcagctggaaggtatcaaacta
gcctatatcggcgacggcaataatgtatgccattcattacttttagccggtgctatggtc
gggatagatatccgccttgcgatgccaaaagggtatgaggtcgacgaaacaattctagca
aaggcagaaaatctggcgaagcaaagtggtggcaagcttttcgttacggaagatccgaaa
cttgcggtgacagatgcggactttatttatacggatgtttggacaagtatgggacaagaa
gatgaaaatgcgaaacgtttggcggattttggcgaaaaatatcaagtaaatgcagaatta
gttagtggtgccaagcctgattaccacttcttacattgtttaccagcacatcgggaagaa
gaagtaaccactgaaattatagatggtatccattcggttatttatcaacaagcgggaaat
aggcttcatgcgcaaaaagcgttattagcagctattctagaagcaaaataa

DBGET integrated database retrieval system