KEGG   Listeria monocytogenes N53-1 (serotype 1/2a): BN419_2372Help
Entry
BN419_2372        CDS       T02513                                 

Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
Organism
lmob  Listeria monocytogenes N53-1 (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_N RVT_2 Steroid_dh
Motif
Other DBs
NCBI-ProteinID: CCQ24647
Position
1929704..1930348
Genome map
AA seq 214 aa AA seqDB search
MTDELEQKALITIFGGTGDLANRKLYPSLYHLYSKGSLGDNFAVIGTARREWSNDFFRDK
VKESIKDIDGSEKDADAFASHFYYQSHDVTNKESYLTLKDLSDELDAKYELDGNRLFYLA
MAPNFFGTIASRIKSEGFVDTDGFHRLIIEKPFGHDLASAEELNNSLRQAFKEDEIYRID
HYLGKEMIQNISVIRFAKLNHFGIIVTSITSKLL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgagttagaacaaaaagcactgattactatttttggcggtacgggagatttg
gcaaatcgcaaactttacccttcgctatatcatttgtacagtaagggatctcttggcgac
aattttgctgttattggaacggctcgtcgtgaatggagtaacgatttcttccgtgataaa
gtaaaagagtctatcaaagacattgacggttctgaaaaagacgcagatgcatttgcttct
cacttctactatcaatctcatgatgtgacaaataaagaatcttatctaactttaaaagat
ttgtctgatgaattagatgcaaaatacgaattagatggcaatcgccttttctatcttgca
atggctccaaatttctttggaactatcgcaagtcgcattaaatctgaaggctttgttgat
acagacggtttccatcgtttaattatcgaaaaaccattcggccatgatttagctagtgcg
gaagaattaaacaattcacttcgtcaagctttcaaggaagatgaaatttatcgtattgac
cattatttaggaaaagaaatgatccaaaatatctcggttattcgttttgcaaaattgaat
cactttggaataatcgttacatcgataacatccaagttactttaa

DBGET integrated database retrieval system