KEGG   Listeria monocytogenes N53-1 (serotype 1/2a): BN419_2543Help
Entry
BN419_2543        CDS       T02513                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
lmob  Listeria monocytogenes N53-1 (serotype 1/2a)
Pathway
lmob00520  Amino sugar and nucleotide sugar metabolism
lmob01100  Metabolic pathways
lmob01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lmob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BN419_2543
Enzymes [BR:lmob01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BN419_2543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: CCQ24806
Position
2061570..2062703
Genome map
AA seq 377 aa AA seqDB search
MAVIKNVKIYKENELIDAVVITEGNLIKEVCSTTPEKYSDEPTFDGNGRLLIPGMIDVHI
HGAKNYDMMDGSTESIQAVSMACAETGCTSFLVTSVSSSLEDLIQMIRQTKKVIGKEKGA
KIAGIHLEGPYLNIEKKGMQNPAHLRHPDLKEMKKIFDEADGLIKMVTIAPELPGGIELI
DFLKKRGVVVAIAHSNATYEEAQDAFEKGASHITHCFNAMPAIHHRAPGLVAAALENDSI
SVQAIVDGVHLHPGIVRLIHKIKGPDKMVLTTDALQAMGVGDGEYIFGGHQVTVTEGVAR
LQDGTLASSTVTMNKSLRLSNEFGINLQDTIQMATSTPADILGMKNLGRIEKGYIADLVL
LDKKFEVLSTWINGEKY
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggccgttatcaaaaatgtgaaaatttacaaagaaaatgaattaatcgatgcagtagtt
attacagaaggaaatttgataaaagaagtttgttcaactactcctgaaaagtattcagat
gagccaacttttgatggaaatggacgattgctaattcctggaatgattgacgttcatatt
catggggcaaaaaattatgatatgatggatggttcaacagaaagcattcaagctgtatct
atggcttgtgcggaaacaggatgtactagttttttagtcacctcggttagttcttctttg
gaagacttaattcaaatgattagacaaacaaaaaaagtgataggaaaagagaaaggtgct
aaaattgcaggaattcacttagaaggcccctaccttaatatcgaaaaaaagggcatgcaa
aacccagcccatttaagacaccctgacctaaaagaaatgaaaaagattttcgatgaagca
gatggtcttattaaaatggtaaccattgctccagagttgcccggaggtatcgaactcatt
gacttcttgaaaaaaagaggcgtagttgttgcaattgcccactccaatgcaacttatgaa
gaggcgcaagatgcctttgaaaaaggcgcatcgcatataactcattgctttaatgctatg
ccggcaatccatcatagggcaccagggcttgtagcagcggctttagaaaatgattcgata
agtgtccaagccatcgtagacggggtccaccttcatcctgggattgtgcgtctcattcat
aaaattaaaggacccgataaaatggttctcacaaccgatgcccttcaagctatgggagtt
ggcgacggcgagtatatttttggcggtcaccaagtaacggttacggaaggagtggcacgc
ttacaagacgggacattagcttcaagtaccgtgacgatgaataaatctttaagattaagt
aatgaatttggtattaacttgcaagacactatacaaatggcaacaagtacacccgcagat
attttaggcatgaaaaatttgggccgaattgaaaaaggttatatcgctgacttggtttta
cttgataaaaaattcgaggttctaagtacgtggattaacggtgaaaaatactaa

DBGET integrated database retrieval system