KEGG   Listeria monocytogenes N53-1 (serotype 1/2a): BN419_2578Help
Entry
BN419_2578        CDS       T02513                                 

Definition
(GenBank) 6-bisphosphate aldolase subunit GatY
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
lmob  Listeria monocytogenes N53-1 (serotype 1/2a)
Pathway
lmob00010  Glycolysis / Gluconeogenesis
lmob00030  Pentose phosphate pathway
lmob00051  Fructose and mannose metabolism
lmob00680  Methane metabolism
lmob01100  Metabolic pathways
lmob01110  Biosynthesis of secondary metabolites
lmob01120  Microbial metabolism in diverse environments
lmob01130  Biosynthesis of antibiotics
lmob01200  Carbon metabolism
lmob01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lmob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN419_2578
   00030 Pentose phosphate pathway
    BN419_2578
   00051 Fructose and mannose metabolism
    BN419_2578
  09102 Energy metabolism
   00680 Methane metabolism
    BN419_2578
Enzymes [BR:lmob01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BN419_2578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase His_biosynth
Motif
Other DBs
NCBI-ProteinID: CCQ24834
Position
complement(2091980..2092834)
Genome map
AA seq 284 aa AA seqDB search
MYVSMKGMLERANKEHYAVMAINCFNLETARAVIDAAQELRAPIIIDLLQDHLTSHLGSR
FLTKPIIKMAEEASVEVAINLDHGHDVAIVKQCLADGFSSVMMDASSFPYEENVAITKKM
VEFAEVYHASVEAEVGNIGAVTGDNYTNQEMYTDPKVAIDFAKRTGIDALAISYGSSHGD
YPEGFTPAFQFDIVREIKSATNMPLVLHGGSGCGAENIRESVRLGINKINVGSDFMKAQV
NQIKTNLKESPAVNYVDLIHETIKAGTKAVKYYIHLSGSTGKSL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtttccatgaaaggtatgttagaacgtgcgaacaaggagcattatgcagtaatg
gcaattaattgttttaatctggaaacagctcgtgcggtcattgatgctgctcaagaactt
cgtgcgccaattatcattgatttacttcaagaccatttgacaagtcatctagggagtcgt
tttttgacaaaacccattataaaaatggcagaagaagcgagtgtcgaggtagcgattaat
ttggatcacgggcatgatgtagcgatagtgaagcagtgcttagcggatggtttttctagt
gtgatgatggatgcgtctagttttccttatgaagaaaacgttgcaattacgaaaaaaatg
gtcgagtttgcggaggtttatcatgcgagtgtcgaggcggaagttggtaatattggcgcg
gtgacaggagataattacactaatcaagaaatgtatactgatcccaaagtggccatcgat
tttgctaaacgaacagggattgacgctttagcaatttcttatggttcttcccatggtgat
tatccagaaggttttacaccagcttttcagtttgatattgtcagagaaatcaaatccgcg
acaaacatgccgctcgttttgcacggaggttctggttgcggggcggaaaacattcgagaa
tccgttcgactaggaatcaataaaatcaatgttggctccgacttcatgaaagcgcaagta
aatcaaataaaaactaacttaaaagaaagtccggccgttaactatgtggacttaattcat
gaaacgataaaagccggcacaaaagctgttaaatattatattcacttatccggttcaacc
ggaaaatcactttaa

DBGET integrated database retrieval system