KEGG   Listeria monocytogenes SLCC5850 (serotype 1/2a): LMOSLCC5850_0170Help
Entry
LMOSLCC5850_0170  CDS       T02223                                 

Gene name
metS
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lmoc  Listeria monocytogenes SLCC5850 (serotype 1/2a)
Pathway
lmoc00450  Selenocompound metabolism
lmoc00970  Aminoacyl-tRNA biosynthesis
lmoc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmoc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LMOSLCC5850_0170 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LMOSLCC5850_0170 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lmoc01007]
    LMOSLCC5850_0170 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lmoc03016]
    LMOSLCC5850_0170 (metS)
Enzymes [BR:lmoc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LMOSLCC5850_0170 (metS)
Amino acid related enzymes [BR:lmoc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LMOSLCC5850_0170 (metS)
Transfer RNA biogenesis [BR:lmoc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LMOSLCC5850_0170 (metS)
 Prokaryotic type
   Other AARSs
    LMOSLCC5850_0170 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f ARL2_Bind_BART DUF2724
Motif
Other DBs
NCBI-ProteinID: CBY50639
Position
170228..172225
Genome map
AA seq 665 aa AA seqDB search
MLPEEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKI
QAKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVEKIFEQLLEQGD
IYLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKY
ADRLVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVW
IDALSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMVF
GHGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVN
FDLANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQILVDFKNNVVKEYEGSMDHMQF
SVALNQLWSLISRTNKYIDETAPWALAKDEDKRTELASVMTHLAENLRIIAVLLQPFLTR
TPGEIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRLDAEVEVTYIQDEMKG
SAPAPAEEVAEVEALETPQIGIEDFDKIDLRVAEVKQVDKVKKADKLLCFQLDLGEGKLR
QVLSGIAEFYQPEELIGKKVIVVSNLKPVKLRGLMSEGMILSGEKDGKLSVIEASSALPN
GAKVK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcctgaagagaaaaatacgttttatattacaacaccaatctattatccaagcgga
aaagcgcatatcggccatgcttatacgactgttgcgggggacgcgatggctcgttataaa
cgtttaaaaggatatgatgtgttttacttaactggaacagatgagcacggtcaaaaaatc
caagcgaaagcgaaagaacgcggaatttctgaacaagaatacgtggatgaaatcgcagaa
ggcttccaagaactttggaaaaaactagaaatttctaatacggattttattcgtacaaca
caagaccgtcataaaacatcggttgaaaaaatctttgaacaacttttagagcaaggcgac
atttacttaggtgaatacgaaggttggtactctgtttctgatgaagaatactttacagaa
acacagttagaagaagtatataaagatgaaaatggcaaagtaatcggcggaaaagctcca
agtggcaatgaagtcgaacttgttaaagaagaatcctacttcttccgcatgagcaaatat
gcggaccgtttagtagaatattataattcccatccagaatttatccttcctgaatccaga
aaaaatgaaatgattaataatttcattaaacctggtttggaagatttagcagtatctaga
acaacttttgattggggtattaaagttcctggtaatccaaaacatgttgtttatgtatgg
attgatgcgctttctaactatattactgcgcttggatataatacggacaatgatacgaaa
ttccaaaaatactggcctgctgatgtacaaatcgttgggaaagaaatcgttcgtttccac
acaatttattggccaattatgctgatggcactagacttaccacttcccaaaatggtattc
ggccatggctggattttaatgaaagatggtaaaatgtcgaagtccaaaggtaacgtagta
gatccttatatgctgattgaccgctacggcctagatgcgcttcgttattacttattacgc
gaagttccatttggctcagatggtttatttacaccagaagactttgttgatcgtgtgaac
tttgatcttgccaacgatttaggaaacttgcttaatcgtacagtagcaatgattaacaaa
tactttgatggtgaaattccggcttatcaaggtaatgtaacagaatttgatcaaatttta
gtagattttaaaaacaatgtggtgaaggaatatgaaggtagcatggatcacatgcaattc
tctgtagctttaaaccaactgtggtcactaatttctcgtacaaataaatatatcgatgaa
actgctccatgggcacttgccaaggacgaagataaacgcacagaacttgcaagcgtaatg
actcatttagcggaaaacttacgtattatcgcagtgcttttacaaccattcttaacaaga
actccgggcgaaatcttcttacaactaggtttacaagaagaaaacttgaaaaaatgggat
agcatttatggatatggtgaaattccagcaggcaccactgtggtgaaaaaaggtacgcca
attttcccgagacttgatgcagaagtggaagttacctatattcaagatgaaatgaaaggc
tctgcaccagcgcctgccgaagaagtggcggaagttgaagcacttgaaacaccgcaaatc
ggcattgaagacttcgacaaaatcgatcttcgtgttgcagaagtaaaacaagtagataaa
gtgaaaaaagcagataaacttctttgtttccaattagatttaggagaaggaaaactacgc
caagtgctttcaggcattgccgaattctatcaaccagaagaactaatcggcaaaaaagtt
atcgtcgtttctaacttaaaacctgtgaaacttcgcggactaatgagcgaaggaatgatt
ctctcaggcgaaaaagatggcaagctaagcgtaattgaagcaagtagcgcacttccaaat
ggtgcgaaagtaaaatag

DBGET integrated database retrieval system