KEGG   Listeria monocytogenes SLCC5850 (serotype 1/2a): LMOSLCC5850_0959Help
Entry
LMOSLCC5850_0959  CDS       T02223                                 

Gene name
nagA-1
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
lmoc  Listeria monocytogenes SLCC5850 (serotype 1/2a)
Pathway
lmoc00520  Amino sugar and nucleotide sugar metabolism
lmoc01100  Metabolic pathways
lmoc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lmoc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LMOSLCC5850_0959 (nagA-1)
Enzymes [BR:lmoc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     LMOSLCC5850_0959 (nagA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: CBY51428
Position
970423..971556
Genome map
AA seq 377 aa AA seqDB search
MANKVITNATIYTGKGVLENAFVRFDKQILEVGSMADFQADKAEEVIDAKGQKLVPGFID
VHSHGGYSFDAMDADSDALRKQVNGMLNEGITTYFPTTMTQSHENIEKALKVINEVAQTE
PVIGGIHLEGPFVSKVFKGAQPEEYIQAPDLELFKKWFDISGGLIKLVTYAPEHDTSADF
ENLCFELGVVPSIGHSNDVREHLKTSKATHATHLYNACHRMTHREPGVPGHVLLERGINA
ELIVDGIHVHPDMVKLAYQMKGPEHLCIITDSMRAKGMPEGKSELGGQTVIVKDKQARLE
DGTLAGSVLTYDDGFRNMIKFTGCSVEEAVLMSSGNQAREFNLTQKGAIEAGKDADFNLL
DEDLHITATYSFGKKHS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggctaataaagtaattactaacgctacaatttatactggtaaaggtgttctagaaaat
gctttcgtacgttttgataaacaaattttagaggttggctcgatggctgattttcaagcg
gacaaagcagaagaagtaatcgatgcaaaaggacaaaaacttgttcctggtttcattgat
gttcattcacacggtggttatagttttgacgcaatggatgcggattcagacgcacttaga
aaacaagtaaatggtatgttaaatgaagggattactacttacttcccaacaacgatgacg
caatcacacgaaaatatcgaaaaagcgctaaaagtgattaacgaagtcgcacaaacagaa
cctgttattggtgggattcatctggaaggcccatttgtttccaaagtctttaaaggagca
caaccagaagaatacatccaagcgcctgatttggaacttttcaaaaaatggtttgatatt
tctggtggcttaattaaattagtaacatatgcaccagagcatgatacttctgctgatttt
gaaaatttgtgtttcgaactaggggttgttccaagtattgggcactctaatgatgtgcgt
gaacacttgaaaacaagtaaagcgacacatgcgacacatttatataatgcttgtcaccgt
atgacacaccgtgagccaggcgttccaggtcacgttttactagaacgcggtattaatgca
gaactaatcgttgatggtattcacgttcatcctgatatggtgaaattagcttatcaaatg
aaagggccagaacatttatgcattatcactgactccatgcgagcaaaaggtatgccagaa
ggaaaatcagaacttggtggtcaaactgttatcgtaaaagataaacaagctcgtttagaa
gatggaactttagctggaagtgtgctcacttatgacgacggcttccgcaacatgattaaa
tttactggatgctcggtagaagaggcagttcttatgtcttctggaaaccaagcacgcgaa
tttaatttaacacaaaaaggtgcaatcgaggctggtaaagatgcagatttcaacttacta
gacgaagatttacacattacagcaacttattcattcggaaaaaaacattcttga

DBGET integrated database retrieval system