KEGG   Listeria monocytogenes SLCC5850: LMOSLCC5850_1318Help
Entry
LMOSLCC5850_1318  CDS       T02223                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lmoc  Listeria monocytogenes SLCC5850
Pathway
lmoc00330  Arginine and proline metabolism
lmoc00332  Carbapenem biosynthesis
lmoc01100  Metabolic pathways
lmoc01130  Biosynthesis of antibiotics
lmoc01230  Biosynthesis of amino acids
Module
lmoc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lmoc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LMOSLCC5850_1318 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LMOSLCC5850_1318 (proB)
Enzymes [BR:lmoc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LMOSLCC5850_1318 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ADH_N_2
Motif
Other DBs
NCBI-ProteinID: CBY51787
Position
complement(1286704..1287534)
Genome map
AA seq 276 aa AA seqDB search
MRESLKNSKRLVIKVGTSTLMYGNGHINLRTIEKLAMVLSDLRNEGKEVILVSSGAIGVG
CHKLQLPVRPTSIPEQQAVASVGQSELMHIYSKFFGEYGQVVGQVLLTRDVTDFPISREN
VMNTLESLLERGIIPIVNENDTVAVEELEHVTKYGDNDLLSAIVAKLVQADLLIMLSDID
GFYGSNPSTDPDAVMFSEINQITPEIEALAGGKGSKFGTGGMLTKLSAASYCMNANQKMI
LTNGKNPTIIFDIMQGEQIGTLFASKKEEFSHDGTH
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaatctttaaaaaatagtaagagactagttatcaaggttggtacaagtacatta
atgtatggaaatggccatattaacctaagaactatcgaaaaattagcgatggttttatcc
gatttacgtaatgaaggaaaagaagttatcttagtttcttctggggcaatcggcgttgga
tgtcataaattacaacttccagtgcgacctacaagtattcccgaacaacaagcagttgct
tctgtcggtcagagtgaattaatgcatatatatagtaagttttttggtgaatacggacaa
gttgttggtcaagtactacttactcgagatgtaactgacttccctattagtagagaaaat
gttatgaacacgctcgaaagtctcttagaacgcggaattattcctatcgtaaatgaaaat
gatacagttgctgttgaggaactagaacatgtaactaaatacggcgataacgaccttctt
tcagctattgtggctaaactcgtgcaagctgatttacttatcatgctatctgatattgat
ggcttttatggtagtaatccttcaactgacccagatgcagttatgttttctgaaatcaat
caaataacaccagaaattgaagcacttgctggcggtaaaggttctaaattcggaactggc
ggcatgttaacgaaactttccgctgcttcttattgtatgaatgctaaccaaaaaatgatt
ttaaccaatggcaaaaatcctacaattatttttgatataatgcaaggtgaacaaatcggg
actttatttgcaagtaaaaaggaggaattttcccatgacggaactcattaa

DBGET integrated database retrieval system