KEGG   Listeria monocytogenes SLCC5850 (serotype 1/2a): LMOSLCC5850_1473Help
Entry
LMOSLCC5850_1473  CDS       T02223                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmoc  Listeria monocytogenes SLCC5850 (serotype 1/2a)
Pathway
lmoc00071  Fatty acid degradation
lmoc00072  Synthesis and degradation of ketone bodies
lmoc00280  Valine, leucine and isoleucine degradation
lmoc00310  Lysine degradation
lmoc00362  Benzoate degradation
lmoc00380  Tryptophan metabolism
lmoc00620  Pyruvate metabolism
lmoc00630  Glyoxylate and dicarboxylate metabolism
lmoc00640  Propanoate metabolism
lmoc00650  Butanoate metabolism
lmoc00900  Terpenoid backbone biosynthesis
lmoc01100  Metabolic pathways
lmoc01110  Biosynthesis of secondary metabolites
lmoc01120  Microbial metabolism in diverse environments
lmoc01130  Biosynthesis of antibiotics
lmoc01200  Carbon metabolism
lmoc01212  Fatty acid metabolism
lmoc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmoc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMOSLCC5850_1473
   00630 Glyoxylate and dicarboxylate metabolism
    LMOSLCC5850_1473
   00640 Propanoate metabolism
    LMOSLCC5850_1473
   00650 Butanoate metabolism
    LMOSLCC5850_1473
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LMOSLCC5850_1473
   00072 Synthesis and degradation of ketone bodies
    LMOSLCC5850_1473
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMOSLCC5850_1473
   00310 Lysine degradation
    LMOSLCC5850_1473
   00380 Tryptophan metabolism
    LMOSLCC5850_1473
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMOSLCC5850_1473
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMOSLCC5850_1473
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LMOSLCC5850_1473
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmoc04147]
    LMOSLCC5850_1473
Enzymes [BR:lmoc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMOSLCC5850_1473
Exosome [BR:lmoc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMOSLCC5850_1473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CBY51942
Position
complement(1445889..1447058)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEINPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAASAQEKNLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDEIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaattcggtggtagt
ttgaaagacatcagtgcagtagatcttggtgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgtgtggatcaagtaatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtgtgtggatctggcttaaaatcggttatgcttggcagacaa
gcaattcaactaggggaagctgacatcgtagcagtaggagggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagccggtgaagaaatcaatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgaatatcacatgggaattact
gcagaaaatgttgcggaaaaattctccgtaacccgagaagaacaagatgaatttgctcat
aactctcaaatgaaggccgcaagtgcacaagaaaaaaacctttttgaagaagaaattatt
cctgtaaaacttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctacgttgaaaagcgtattcaaagaaggtggaactgttacagcc
ggtaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaggttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgaaattgatttattccatttaaacgaagcttttgcatcgcagtct
gttgcagtggctcgtgatttgaaaattcccgaagagaaacttaatatttacggtggagca
attgcgctaggtcatccaatcggagcttccggcgcacgcattattgcctctttgttaaat
gaattaaaacatgaaaacaagcatatcggggtagcttccttgtgcgttggtggtggtatt
ggcattgcaattatccttgaaagagcatga

DBGET integrated database retrieval system