KEGG   Listeria monocytogenes SLCC5850 (serotype 1/2a): LMOSLCC5850_2169Help
Entry
LMOSLCC5850_2169  CDS       T02223                                 

Gene name
feoB
Definition
(GenBank) ferrous iron transport protein B
  KO
K04759  ferrous iron transport protein B
Organism
lmoc  Listeria monocytogenes SLCC5850 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmoc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lmoc02000]
    LMOSLCC5850_2169 (feoB)
Transporters [BR:lmoc02000]
 Other transporters
  Others
   LMOSLCC5850_2169 (feoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FeoB_N Gate FeoB_C MMR_HSR1 FeoB_Cyto SRPRB Parvo_NS1
Motif
Other DBs
NCBI-ProteinID: CBY52638
Position
2184942..2186936
Genome map
AA seq 664 aa AA seqDB search
MSQNTYCLLGNPNTGKTSLFNALTGSYEYVGNWSGVTVEKKVGTLRSKTGKLIDLPGIYD
LNPISRDETVVTRFLLEEKFDCMLNIVDSSQIERNLNLTIQLLEFGAPVVMGLNMIDVAA
GRGIHLNIQNLAKKLRIPILPVVARSGKGTDDILTTLSEKHVAPAIPLVLPYGEPAEKAI
AEIQALTKDIIPAKQSRWLAVQFLSKNEVTEEFLTTSPMFEQLKDIRSDLEIALAGKLEN
HFHQVRVNYIHDICLTSVEYTRNSDIPLSDKLDKIFTHKFFGIPIFLGIMWLIFQITFTW
VGAPLSDLLDGFIGGSLTDWVTSFLTTIGASGFITDLVADGIIAGVGGVLVFVPQILVIF
FFISVLEDSGYMARIAVVMDRVMEIFGLNGKAFIPMIIGFGCNVPGIMAARSIEESKERT
LTILVSPFMSCSARLPVYALFVGVFFEKYQALVVLSLYVIGILMALIVTKILSKTLLKKD
NSVFVVELPPYRLPSLKTLWRSTWEKGKGFLRKAGTFIFAGSVIIWLLNYAGPSGLDVPM
GESFLAIIGGMLAPLLVPLGFGTWQAGATLIPGFLAKEVVVSTMAIIYAVGESSMGSIVS
TFYTPLSAYCFMLFILLYIPCLATVAAIRKETSSWKWTAFAVAYPLITAYVLVFLVYQIG
SLFV
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaatacttattgcctactcggaaacccgaataccgggaaaacttctttattt
aacgcattaacaggctcttatgaatatgtaggaaactggagcggagttaccgttgaaaag
aaagtcggtactttgcgctccaaaacaggaaaattaattgatttacctggaatttatgac
ttaaacccgatttctcgtgatgaaacagttgtcactagatttttattagaagaaaaattt
gattgtatgttaaatattgtcgattcatcgcaaattgaacgaaatttaaatttaacgatt
cagctccttgagttcggcgcacctgttgtgatgggtcttaatatgattgacgttgccgct
ggtcgtggcattcatttaaacatccaaaacttagcaaaaaaactgcgcattccgattttg
ccagtcgtcgctcgttctgggaaaggtaccgatgatatattaactactttatcggaaaaa
catgtggcaccggcgattccgcttgttttaccatacggagaacccgcagagaaagctatc
gcagaaatccaagctttaactaaagatattatccctgctaagcaatctcggtggctcgca
gttcaatttctttctaaaaatgaagtcacagaagaatttttaacgactagccctatgttt
gaacaattgaaagatatacgctcagatttagaaattgcgcttgccggcaaattagaaaat
cactttcatcaagttcgcgtgaattacattcatgatatttgtttgacttcagtcgaatac
acgcgcaattcagatattccactatccgacaaactcgataaaattttcacgcataagttt
ttcgggattccgattttccttggtattatgtggttaattttccaaataacctttacttgg
gttggcgcaccgctgtccgatttgctcgatggttttatcggtggctcgctgacagattgg
gtgacttccttcttaacaaccatcggcgcatctggatttattactgatttggttgcagat
ggtatcatcgctggtgttggtggcgtgctcgtctttgttcctcaaatcttggttattttc
ttcttcatttctgtcttagaagattccggatacatggctagaattgcggttgttatggac
cgcgtaatggaaattttcggcttaaatggaaaagcatttattcccatgattatcggtttt
ggttgtaatgttcctggaattatggcagctcggtcgattgaagaatccaaagaacgtaca
ttaaccattctcgtatcaccattcatgtcttgttctgcgcgccttcccgtatacgctctt
ttcgttggggtattttttgaaaaatatcaagcgcttgtcgttctatcactatacgtgatt
ggtattttaatggcacttatcgtcactaaaattttatcaaaaactttacttaaaaaagat
aattccgtattcgtcgtcgaactaccgccctaccgcttgccatcgcttaaaactttatgg
cgtagcacatgggaaaaaggaaaaggattcttgcgtaaagcgggaacattcattttcgca
ggttctgtgatcatttggttactaaactacgctggtccatcaggactcgacgtaccaatg
ggtgaaagtttcttagcaattattggtggcatgctcgctccactactcgttccgctaggt
tttggaacttggcaagcgggagcgacacttattcctggttttctagcaaaagaagtggta
gtttctacgatggcaattatttatgctgttggagaaagctccatgggaagtatcgttagc
accttttatacaccactttcggcttattgctttatgttgtttatcttgctttacatccca
tgtttagcgacagttgccgccattcgtaaagaaactagttcttggaaatggaccgcattt
gccgtcgcctatccactcattacagcctacgtattagtatttctcgtttatcaaatcgga
agtctattcgtttaa

DBGET integrated database retrieval system