KEGG   Listeria monocytogenes SLCC5850 (serotype 1/2a): LMOSLCC5850_2355Help
Entry
LMOSLCC5850_2355  CDS       T02223                                 

Definition
(GenBank) FMN reductase, NADPH-dependent
  KO
K00299  FMN reductase [EC:1.5.1.38]
Organism
lmoc  Listeria monocytogenes SLCC5850 (serotype 1/2a)
Pathway
lmoc00740  Riboflavin metabolism
lmoc00920  Sulfur metabolism
lmoc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmoc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    LMOSLCC5850_2355
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    LMOSLCC5850_2355
Enzymes [BR:lmoc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.38  FMN reductase (NADPH)
     LMOSLCC5850_2355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_2
Motif
Other DBs
NCBI-ProteinID: CBY52824
Position
complement(2377513..2378058)
Genome map
AA seq 181 aa AA seqDB search
MGKVTIIAGGIKTESRLTGLTQLAANELVTNGLEVNIIEVHKINAEALVTADFAHSDIQL
ANSEIESSSGVIIATPIFKAAYSGVLKVYLDLLPLKALKGKVVLPLGLGGSNGHLLALQY
ALDPVLRELGAETILKGQFTVDKQIERLGDGLYEIESSAKERLDIALGQFISLLNQQSVE
V
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagtgacaattattgctgggggaatcaaaacagaatccaggcttacaggatta
actcaactagcggcaaatgaattagtaacgaatggcttagaagtgaacatcatcgaagtg
cataaaataaacgcagaagcattagtcaccgcggatttcgcgcattcagatattcaattg
gcaaatagtgaaattgaatcaagttcgggcgttattattgctaccccgattttcaaagcg
gcctattcaggagtgttaaaagtctatttggaccttttgccactcaaagctttgaaaggg
aaagtcgttttgccacttgggcttggtgggtcaaatggacatttgctcgcactgcaatac
gcacttgatcctgtgttgagggaacttggagcggaaacgatattaaaagggcaatttacg
gtagataaacaaattgaacggctcggggatgggctgtatgaaattgaatcttcagcgaaa
gaacggttagacattgctttaggccaatttatttcgttattaaatcagcagtcagtagaa
gtttaa

DBGET integrated database retrieval system