KEGG   Listeria monocytogenes EGD (serotype 1/2a): LMON_0414Help
Entry
LMON_0414         CDS       T02872                                 

Definition
(GenBank) Probable low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
lmod  Listeria monocytogenes EGD (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmod00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    LMON_0414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Ferlin_C Myc_target_1
Motif
Other DBs
NCBI-ProteinID: CDG44278
UniProt: A0A3Q0NBI1
Position
426440..427447
Genome map
AA seq 335 aa AA seqDB search
MDTVILITVIIVIVGLAFDFINGFHDIANAVATSISTRALKPRVAIGIAAVMNFLGAISF
TGVAESLTKSIVDPFSLNNGEFVVLCGLIAAVIWNLMTWLVGMPSSSSHALIGAIAGASI
ASASSFSVLNWSGFTTIIIALIISPIIGFTVGYLIYSLFKHLFHDKKLGKMNRRFRFIQI
GTAAAQAYSHGTNDAQKTMGIITLALVASGLLKESAGIPFWVQVSCAASMAIGSSVGGYR
IIKTVGTKIMKITPVTGVASDLSSLSVIMTATLIHLPVSTTQVIDSSIMGVGTANHKKEV
NWRTGKNMVVTWFITLPLAGLLAAVVYWISAAIFL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggatacggttattttaataacggttattatcgttatagtggggttagcgtttgatttt
ataaatgggtttcatgatattgcgaatgcggttgccacgagcatttcaactagagcttta
aaaccgcgagtagcaattggtattgcggcagttatgaatttcctgggagccatttcgttt
acaggggtagctgaatcgctcaccaaaagcattgtagatccattttcgcttaataatggg
gaatttgtcgttttatgtggcttaatagcggcagtgatttggaatttaatgacttggctt
gttggaatgcctagtagttcatcgcatgcgcttatcggtgcgatagctggggcttccatc
gcatcagccagtagttttagcgtgcttaattggtcaggatttacaactattattattgca
ctcattatctcaccaattatcggttttacagtcggttatttgatttattcgctctttaag
catctttttcacgacaaaaagcttgggaaaatgaatcggcgctttcgttttatccaaatt
ggaactgctgcagcccaagcatattcacacggcacaaatgatgcgcaaaaaacgatgggg
attattacgcttgctttagttgcgagtggacttttgaaagagtcagccggtattccattt
tgggtgcaagtaagttgtgcagcatcgatggcgattgggtcatctgttggcggttatcga
atcattaaaacagtaggaacaaaaatcatgaaaataaccccagttactggtgttgcatct
gatttaagctctctttccgtaatcatgacagctactttgattcatttgccagtcagcact
acgcaagttattgacagctcgattatgggtgtcggaacagctaatcataaaaaagaagtc
aattggcgtacggggaaaaatatggttgtaacttggtttattacgttaccactagctgga
cttttggcagcagtggtatactggatatcagcagctatttttttataa

DBGET integrated database retrieval system