KEGG   Listeria monocytogenes EGD (serotype 1/2a): LMON_1745Help
Entry
LMON_1745         CDS       T02872                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase / Homolog of homocysteine-binding domain
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
lmod  Listeria monocytogenes EGD (serotype 1/2a)
Pathway
lmod00270  Cysteine and methionine metabolism
lmod00670  One carbon pool by folate
lmod01100  Metabolic pathways
lmod01110  Biosynthesis of secondary metabolites
lmod01120  Microbial metabolism in diverse environments
lmod01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmod00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LMON_1745
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LMON_1745
Enzymes [BR:lmod01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     LMON_1745
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     LMON_1745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans MTHFR DUF737
Motif
Other DBs
NCBI-ProteinID: CDG45598
UniProt: A0A3Q0NFA9
Position
complement(1735093..1736946)
Genome map
AA seq 617 aa AA seqDB search
MNLRKDLSEKVLIADGAMGTLLYSYGVDRSFEELNLSHPEDIVAIHKAYIGAGADIIQTN
TYGANYIKLARYGLEDEVKRINQAAIRLAKEAARGTGTYIFGTIGGINGAVDARLPAAPL
EEIKRSFREQLYCFLLDGVDAILLETYYDLDELKTVLKILRETTDLPVVANVSMHEPGIL
QNGKKLPDALEELIALGADVVGINCRLGPYHMARALETVPLYDNAYLAVYPNASLPEMQE
GKVIYQSDTDYFEHYGEVFRQEGARIIGGCCGTTPDHIRALRKGLETTKPILEKEVRPIL
ELVPEEVEDVDSGERLLDKVKERLTILVELDPPRTFDTTKFFEGAQALDEAGVDAITISD
NSLATPRISNMALASILKHEYGIKPLIHLTTRDHNLVGMHSHVMGFHKLGLHDVLAITGD
PTKVGDFPGASSVFDLRSVELVQLIKKFNEGISYTGKSLKEKARFHVGAAFNPNVLNLEK
AVRLIERKVEYGADYIITQPIYDVNKAILLKEALQKANIDVPLFIGVMPLLSSRNAEFLH
NEVPGIRLTDDVRERMREAEEHGHANEEGMAIARELVDAICEHFQGIYIITPFLRYDLSI
ELAKYAQNKQQVQIGSK
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
gtgaatttaagaaaagatttaagcgaaaaagtattaattgctgacggtgcgatgggcact
ttgctttattcttatggagtggatcgttcgtttgaggagctaaatttgtctcatccggaa
gatattgttgcgattcataaagcgtacattggtgctggggcggatattatccaaacgaat
acgtatggcgcaaattatattaaattagcgcgatatggtttagaggatgaagtgaagcgt
attaatcaagcagctattcgattggcaaaggaagcggcaagagggactggaacgtatatt
tttgggacgattggcggaataaatggcgctgtagatgcaagacttccggcggctccactc
gaagaaatcaagcgaagttttagggagcagctatactgttttttgttagatggcgtggat
gcgattttgctagaaacatattatgatttagatgagcttaagacagtgttgaaaattctt
cgcgagactactgatttaccagtagttgcgaatgtttctatgcatgaaccgggtattttg
caaaacgggaaaaaattgccggatgcgctggaagagcttattgcgctgggggcggatgta
gttggtattaattgccgtcttggtccgtatcacatggcgcgtgctcttgaaacagtgccg
ctgtatgataatgcttatttggcagtttatcccaatgctagtttgccagagatgcaagaa
ggaaaagtgatttatcagtctgatacggattattttgaacattatggggaggtttttcgg
caagaaggcgctcggattattggtggttgttgtggcacgacaccagaccatatccgcgct
ttgcgaaaaggccttgaaacaacaaaacccattttggaaaaagaagttcggccgatattg
gaacttgttccagaagaagtggaggatgtggattctggtgaacgtttgcttgataaagtg
aaggaacgtttaacgattttggttgaactagatccgccgcggacttttgatacgacgaaa
ttttttgaaggagcccaggcacttgacgaggcaggcgttgatgcgattacgatttcggat
aattcgcttgccacgccgcggattagtaatatggcgcttgcttcgattttgaagcatgaa
tatggtattaaaccactcattcatttgacgacacgggatcataatttggttgggatgcat
tcgcatgtgatgggatttcataaattggggctgcatgatgtgcttgcaattacaggtgat
ccaactaaagtaggtgatttccctggagcatcttcggtatttgatttaaggtctgtggaa
ttagttcagctaattaaaaagttcaatgagggaatttcttataccgggaagtcgctgaaa
gaaaaggcacgattccatgttggagcggcatttaatccgaatgtgctgaacttagagaaa
gcggttaggttaattgagcgaaaagtggaatatggtgctgattatattattacacagcca
atttatgatgtgaataaagctatcttattaaaagaagccttgcaaaaagcgaatattgat
gtgccactttttattggggttatgccattattgtctagtcggaatgcggaatttctgcat
aatgaggttcccgggattcgtttgacagatgatgtacgggagcgaatgagagaggcggaa
gagcacggtcatgcaaatgaagaagggatggcaattgctcgtgaattagtggatgcgatt
tgtgagcatttccaagggatttatattattacgccatttttacgatatgatttatcgata
gaattagcgaaatatgcccaaaataaacagcaggtccaaattggatctaaataa

DBGET integrated database retrieval system