KEGG   Listeria monocytogenes EGD (serotype 1/2a): LMON_1911Help
Entry
LMON_1911         CDS       T02872                                 

Definition
(GenBank) Ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
lmod  Listeria monocytogenes EGD (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmod00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lmod03009]
    LMON_1911
Enzymes [BR:lmod01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     LMON_1911
Ribosome biogenesis [BR:lmod03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LMON_1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 Phage_Cox
Motif
Other DBs
NCBI-ProteinID: CDG45763
UniProt: A0A3Q0NFM5
Position
complement(1918685..1919596)
Genome map
AA seq 303 aa AA seqDB search
MQNETLIIEESHARERVDKVIAEMMGKSRSAIQLMLKNGDITVNGELAKPNYKVQVGDEI
HYEVREPEELEVLAEDIPLDIYFEDKDMLVVNKPEGMVVHPSAGHASGTLVNALLFHCDD
LSGINGKIRPGIVHRIDKDTSGLLMVAKNDHAHESLAKQLKDKTSDREYIALVHGDIVHQ
KGTIEAPIGRAKEDRQKMAVVRDGKEARTHFEVLERLPGYTLINCKLDTGRTHQIRVHLK
YIGHPLAGDPKYGPKNTIKGNGQFLHAAKLGFDHPTTNERMTFEAPLPSSFEKALKSLRQ
EEY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgaaacattgattatagaagaaagccacgcgcgcgaacgtgtggacaaagtg
attgctgaaatgatgggaaaaagtcgttcagcaatacaactcatgctgaaaaacggtgat
attacggttaatggagaacttgcgaagccaaattacaaagtacaagttggcgatgaaatt
cattacgaagtgcgtgaaccagaagaactagaagttttagcagaagatattccactagat
atatattttgaagataaagatatgcttgttgtaaataaacctgaaggaatggttgttcat
ccatctgcgggacatgcaagtggaacgctcgttaatgctttactattccattgtgatgat
ttatctggaattaacggtaaaattcgtccaggtattgttcaccgaattgataaagataca
tctggcttattaatggttgccaaaaatgaccacgcccatgaatcactagccaaacaatta
aaagacaaaacttcggatagagaatatatcgcacttgtccacggtgatattgtccaccaa
aaaggaacaatcgaagcgccaatcggccgtgccaaagaagatcgtcaaaaaatggcagtc
gtacgcgatgggaaagaagcgagaacgcattttgaagtattagagcgcctaccaggttac
acattaattaattgcaaactagacactggacgtacgcaccaaatccgagttcatttgaaa
tatatcggtcatcctttagcaggagatccgaaatacggacctaaaaacacaatcaagggc
aatggccaatttctccatgccgcaaaattaggatttgatcatccgacaacgaatgaacga
atgacatttgaagcgccactaccaagttcatttgaaaaagctttaaaatcattacgtcaa
gaagaatattaa

DBGET integrated database retrieval system