KEGG   Listeria monocytogenes La111 (serotype 1/2a): BN418_0971Help
Entry
BN418_0971        CDS       T02512                                 

Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lmoe  Listeria monocytogenes La111 (serotype 1/2a)
Pathway
lmoe00900  Terpenoid backbone biosynthesis
lmoe01110  Biosynthesis of secondary metabolites
lmoe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lmoe00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN418_0971
Enzymes [BR:lmoe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     BN418_0971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: CCQ20196
UniProt: A0A473BUZ3
Position
784560..785840
Genome map
AA seq 426 aa AA seqDB search
MNAFDKFYKKTVEERHAILAEYADLNEEEQAFLASTGALSFDKANHMIENTIGIYSLPLG
LGMNMLLNDKRYIVPMAMEEPSVVAAQSAGAKLIAQNGGITGSATKRKMIGQIELISVSD
IQAAKENIIANEEQLIAIANQAHPSLQKRGGGAVEIQVRTAQTANDETLLIVHLLVDTQE
AMGANMVNTMVETLAPELEMLTNGTANMRILSNLVDEATATAVCRINPESLATKTQSGEW
VRDRIIAAYEFADADIYRAATHNKGIMNGIDAVIMAFGNDWRAVEAASHAYAARTGSYKP
MSKWSKDADGYLVGELTLPMPVAFVGGSIAIHPIASLSKKIARVESAKELAMLVCAVGLT
QNLAALKALVTEGIQRGHMSLQAKSLAMTAGAEADEIEIVATFLQESKQLNVVAAKEFIA
KLRSEK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcttttgataaattttataaaaaaacagtagaagaacgacatgcaattttggcg
gaatatgctgatttaaatgaagaagaacaagcatttttagcttctacaggggcgctttct
tttgataaagcgaatcatatgattgaaaacacgattggtatttattcgctgccgctcgga
ttaggaatgaatatgcttttaaatgataaacgttatattgtacccatggcgatggaggag
ccttctgttgtggcggcacaaagcgctggggcaaaacttattgcacaaaatggcgggata
actggaagtgcaacgaaacgaaaaatgattggtcagattgagttgatttctgtctctgat
atccaagcagcaaaagaaaacatcatcgcgaacgaagaacaactaattgctatcgctaac
caagcgcatccatcgttacaaaagcgtggcggtggtgcggttgaaattcaagtcagaaca
gcacaaacagccaacgacgaaacgttacttatcgttcatttactcgtagacacgcaagaa
gcaatgggcgcgaacatggtcaatacgatggtcgaaaccctagcaccagaattagaaatg
ttgacgaacggaacagccaatatgcgcattttatctaatttagtagatgaagcgaccgca
actgctgtttgtcggattaatccagaaagcttagcaaccaaaacccagagcggtgaatgg
gttcgtgatagaattattgctgcatatgaatttgccgacgcggatatttaccgggcagca
acacataataaaggaataatgaatggtattgatgcggtaattatggcgtttgggaacgat
tggcgcgcggtagaagcagcaagtcacgcctacgcagccagaacaggaagctataaaccg
atgtctaagtggtcaaaagatgcggacgggtatttggttggggagctaactttaccgatg
ccagtggcctttgtaggtggttctatagcgattcatccgattgcgagtctttctaaaaaa
attgctcgagtagaatcagcgaaggaactagcgatgttagtttgtgccgttggattaacg
caaaatctcgctgctttaaaagcactcgtaacagaaggtattcaacgtggtcatatgtca
ctacaagcgaaatctcttgcaatgacagctggcgcagaagcagatgaaatcgaaatagta
gccacatttttgcaagaaagcaaacaattaaacgtagtcgctgccaaagaatttatcgcg
aaattacgcagcgaaaaataa

DBGET integrated database retrieval system