KEGG   Listeria monocytogenes La111 (serotype 1/2a): BN418_1660Help
Entry
BN418_1660        CDS       T02512                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmoe  Listeria monocytogenes La111 (serotype 1/2a)
Pathway
lmoe00071  Fatty acid degradation
lmoe00072  Synthesis and degradation of ketone bodies
lmoe00280  Valine, leucine and isoleucine degradation
lmoe00310  Lysine degradation
lmoe00362  Benzoate degradation
lmoe00380  Tryptophan metabolism
lmoe00620  Pyruvate metabolism
lmoe00630  Glyoxylate and dicarboxylate metabolism
lmoe00640  Propanoate metabolism
lmoe00650  Butanoate metabolism
lmoe00900  Terpenoid backbone biosynthesis
lmoe01100  Metabolic pathways
lmoe01110  Biosynthesis of secondary metabolites
lmoe01120  Microbial metabolism in diverse environments
lmoe01130  Biosynthesis of antibiotics
lmoe01200  Carbon metabolism
lmoe01212  Fatty acid metabolism
lmoe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmoe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN418_1660
   00630 Glyoxylate and dicarboxylate metabolism
    BN418_1660
   00640 Propanoate metabolism
    BN418_1660
   00650 Butanoate metabolism
    BN418_1660
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN418_1660
   00072 Synthesis and degradation of ketone bodies
    BN418_1660
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN418_1660
   00310 Lysine degradation
    BN418_1660
   00380 Tryptophan metabolism
    BN418_1660
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN418_1660
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN418_1660
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN418_1660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmoe04147]
    BN418_1660
Enzymes [BR:lmoe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN418_1660
Exosome [BR:lmoe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN418_1660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCQ20847
UniProt: A0A1D2IQF9
Position
complement(1340268..1341437)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEINPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAASAQEKKLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDEIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaattcggtggtagt
ttgaaagacatcagtgcagtagatcttggtgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgtgtggatcaagtaatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtgtgtggatctggcttaaaatcggttatgcttggcagacaa
gcaattcaactaggggaagctgacatcgtagcagtaggagggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagccggtgaagaaatcaatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgaatatcacatgggaattact
gcagaaaatgttgcggaaaaattctccgtaacccgagaagaacaagatgaatttgctcat
aactctcaaatgaaggccgcaagtgcacaagaaaaaaaactttttgaagaagaaattatt
cctgtaaaacttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctacgttgaaaagcgtattcaaagaaggtggaactgttacagcc
ggtaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaggttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgaaattgatttattccatttaaacgaagcttttgcatcgcagtct
gttgcagtggctcgtgatttgaaaattcccgaagagaaacttaatatttacggtggagca
attgcgctaggtcatccaatcggagcttccggcgcacgcattattgcctctttgttaaat
gaattaaaacatgaaaacaagcatatcggggtagcttccttgtgcgttggtggtggtatt
ggcattgcaattatccttgaaagagcatga

DBGET integrated database retrieval system