KEGG   Listeria monocytogenes La111 (serotype 1/2a): BN418_1834Help
Entry
BN418_1834        CDS       T02512                                 

Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lmoe  Listeria monocytogenes La111 (serotype 1/2a)
Pathway
lmoe00020  Citrate cycle (TCA cycle)
lmoe00480  Glutathione metabolism
lmoe01100  Metabolic pathways
lmoe01110  Biosynthesis of secondary metabolites
lmoe01120  Microbial metabolism in diverse environments
lmoe01130  Biosynthesis of antibiotics
lmoe01200  Carbon metabolism
lmoe01210  2-Oxocarboxylic acid metabolism
lmoe01230  Biosynthesis of amino acids
Module
lmoe_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lmoe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN418_1834
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BN418_1834
Enzymes [BR:lmoe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BN418_1834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CCQ21020
UniProt: A0A1C7PXW8
Position
complement(1498831..1500093)
Genome map
AA seq 420 aa AA seqDB search
MSQKIQVENGVLKTPNNPVIPFIEGDGTGPDIWAAAKRVLDAAVKKAYNGEKEIAWKEVL
AGEKAFKQTGEWLPQATLDTIDEYLIAIKGPLTTPIGGGIRSLNVALRQELDLYVCLRPV
RYFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEFKEGSIESKKLIDFLKSEFGVDKIRFP
ETSGIGIKPISKEGTERLVRSAIEYAIKEGRKSLTLVHKGNIMKFTEGAFKNWGYDLCER
EYGDKVFTWNEYDRIKEAEGTEVADAKQNEALAAGKILVKDSIADIFLQQILTRPAEFDV
VATMNLNGDYISDALAAQVGGIGIAPGANINYLTGHAIFEATHGTAPKYAGLDKVNPSSV
ILSGTLLLEHIGWGEAAALINQSMEKTIAAKTVTYDFARLMDGATEVKCSEFADELIKNF
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaaattcaagtagaaaacggtgtgctaaaaacaccaaacaatccagtcatt
ccttttattgaaggggacggaactggtccagacatctgggcagctgcgaaacgcgtttta
gatgccgcagtaaaaaaagcttacaatggtgaaaaagaaattgcttggaaagaagtatta
gctggcgaaaaagcattcaagcaaacaggagaatggttaccacaggcgactttagataca
attgacgaatatttgattgctattaaaggaccacttactactccaatcgggggaggcatt
cgttcactaaacgttgccctgcgccaagagttagatttatatgtttgtttacgtccagtt
cgttatttcaaaggtgttccttcaccagtgaaacgtccagaagacacagatatggtcatt
ttccgtgagaatacagaagatatttatgcagggattgaatttaaagaaggtagcatagaa
tcgaaaaaactaatcgacttcttaaaatctgaatttggtgttgataaaatccgtttcccg
gaaacttctggaattggtatcaagccgatttccaaagaaggaacggagcgtttagtgcgt
tcggcgattgaatatgcaattaaagaaggtcgtaaatcattaacgctcgtacacaaaggg
aatatcatgaagttcacagaaggagctttcaaaaattggggctatgacttatgtgaacgc
gaatatggtgataaagtatttacttggaatgagtatgatcgaattaaagaagcagaagga
acagaagttgctgacgcgaaacaaaacgaagcgcttgctgctgggaaaattttagtcaaa
gattcgattgcggatattttcttgcaacaaatcttaactcgcccagctgaatttgatgta
gttgctacaatgaacttgaatggagactacatttccgatgcgcttgctgctcaagtaggc
ggaatcggtattgctccaggagcaaacattaactacttaactggtcatgcgattttcgaa
gcgacgcatggtactgctccgaaatatgccggtcttgataaagtaaatccgtcatcggtt
attttatctgggacacttctgcttgaacacattggttggggtgaagcggctgccttaatt
aatcaatcaatggaaaaaaccattgctgcgaaaacggtaacctatgattttgctcgatta
atggatggtgcgacagaagttaaatgttcggaatttgcggacgaattaataaaaaacttc
taa

DBGET integrated database retrieval system