KEGG   Listeria monocytogenes La111 (serotype 1/2a): BN418_2254Help
Entry
BN418_2254        CDS       T02512                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
lmoe  Listeria monocytogenes La111 (serotype 1/2a)
Pathway
lmoe00670  One carbon pool by folate
lmoe00790  Folate biosynthesis
lmoe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmoe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BN418_2254
   00670 One carbon pool by folate
    BN418_2254
Enzymes [BR:lmoe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BN418_2254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: CCQ21400
UniProt: A0A2A5UPZ9
Position
complement(1827611..1828093)
Genome map
AA seq 160 aa AA seqDB search
MIIFVWAQDRAGNIGKDNKMPWHLPGDLQFFKKTTTGKTLVMGRKTYESLGKALPNRKTI
VLTRDQGLKLDDAEILHSKEAVLALAETGEPIYIVGGAEIYRLFMDVADQLIVTKIDAEF
EADTAFPEVDWENFSEVAKEFHEKDEKNKYNYTFYTYERN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattatttttgtttgggcacaagaccgcgctggtaatattggaaaagataacaaaatg
ccgtggcacttaccaggagatttgcagtttttcaaaaaaacgacgactggtaaaacactt
gtcatggggcggaaaacctatgaatcgttaggaaaagctttaccaaatagaaagacaatc
gtattgacacgagatcaaggtctcaagttagatgatgcagagatacttcattcaaaagaa
gctgttttagcccttgctgagacaggggaaccaatctatatagttggtggtgcagaaatc
tatcgtttatttatggatgtggcggatcagctgattgtgacaaaaattgatgcagagttt
gaggctgatactgcgtttcctgaagtggattgggagaatttttccgaagtggcgaaagaa
ttccatgaaaaagatgaaaaaaataagtacaattacactttttatacgtatgaaagaaat
tag

DBGET integrated database retrieval system