KEGG   Listeria monocytogenes La111 (serotype 1/2a): BN418_2370Help
Entry
BN418_2370        CDS       T02512                                 

Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
lmoe  Listeria monocytogenes La111 (serotype 1/2a)
Pathway
lmoe00030  Pentose phosphate pathway
lmoe00480  Glutathione metabolism
lmoe01100  Metabolic pathways
lmoe01110  Biosynthesis of secondary metabolites
lmoe01120  Microbial metabolism in diverse environments
lmoe01130  Biosynthesis of antibiotics
lmoe01200  Carbon metabolism
Module
lmoe_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
lmoe_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:lmoe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BN418_2370
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BN418_2370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmoe04147]
    BN418_2370
Enzymes [BR:lmoe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BN418_2370
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BN418_2370
Exosome [BR:lmoe04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BN418_2370
  Exosomal proteins of colorectal cancer cells
   BN418_2370
  Exosomal proteins of bladder cancer cells
   BN418_2370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_N RVT_2 Steroid_dh
Motif
Other DBs
NCBI-ProteinID: CCQ21515
Position
1929825..1930469
Genome map
AA seq 214 aa AA seqDB search
MTDELEQKALITIFGGTGDLANRKLYPSLYHLYSKGSLGDNFAVIGTARREWSNDFFRDK
VKESIKDIDGSEKDADAFASHFYYQSHDVTNKESYLTLKDLSDELDAKYELDGNRLFYLA
MAPNFFGTIASRIKSEGFVDTDGFHRLIIEKPFGHDLASAEELNNSLRQAFKEDEIYRID
HYLGKEMIQNISVIRFAKLNHFGIIVTSITSKLL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgagttagaacaaaaagcactgattactatttttggcggtacgggagatttg
gcaaatcgcaaactttacccttcgctatatcatttgtacagtaagggatctcttggcgac
aattttgctgttattggaacggctcgtcgtgaatggagtaacgatttcttccgtgataaa
gtaaaagagtctatcaaagacattgacggttctgaaaaagacgcagatgcatttgcttct
cacttctactatcaatctcatgatgtgacaaataaagaatcttatctaactttaaaagat
ttgtctgatgaattagatgcaaaatacgaattagatggcaatcgccttttctatcttgca
atggctccaaatttctttggaactatcgcaagtcgcattaaatctgaaggctttgttgat
acagacggtttccatcgtttaattatcgaaaaaccattcggccatgatttagctagtgcg
gaagaattaaacaattcacttcgtcaagctttcaaggaagatgaaatttatcgtattgac
cattatttaggaaaagaaatgatccaaaatatctcggttattcgttttgcaaaattgaat
cactttggaataatcgttacatcgataacatccaagttactttaa

DBGET integrated database retrieval system