KEGG   Listeria monocytogenes serotype 4b LL195: BN389_00660Help
Entry
BN389_00660       CDS       T02416                                 

Gene name
purA
Definition
(GenBank) Adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
lmog00230  Purine metabolism
lmog00250  Alanine, aspartate and glutamate metabolism
lmog01100  Metabolic pathways
Module
lmog_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:lmog00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BN389_00660 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN389_00660 (purA)
Enzymes [BR:lmog01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     BN389_00660 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: CCO62640
UniProt: A0A0E1R3Z8
Position
65078..66370
Genome map
AA seq 430 aa AA seqDB search
MSSVVVVGTQWGDEGKGKITDFLSENAEAIARYQGGNNAGHTIKFDGVTYKLHLIPSGIF
YKEKISVIGNGMVVDPKALVEELKYLHDKGVDTSNLRISNRAHIILPYHIRIDEADEERK
GANKIGTTKKGIGPAYMDKAARVGIRIIDLLDKETFKEKLEHNLGEKNRLLERFYELEGF
KLEDILEEYYDYGQQFKEYVCDTSVVLNDALDDGKRVLFEGAQGVMLDIDQGTYPFVTSS
NPIAGGVTIGSGVGPSKINHVVGVAKAYTTRVGDGPFPTELFDTIGDTIREVGHEYGTTT
GRPRRVGWFDSVVVRHARRVSGLTDLSLTLLDVLTGIETLKICVAYKLDGKTITEFPASL
KDLARCEPVYEELPGWTEDITGVTSLDDLPVNCRHYMERIAQLTGVQVSMFSVGPDRAQT
HVIKSVWRLA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagttgttgtagtaggaacacagtggggcgatgaaggaaaagggaagattaca
gattttctttccgaaaatgcagaagcgattgctagatatcaaggtgggaacaatgcaggc
catacaattaagtttgatggcgtaacgtacaaattacacttaattccatcaggtatcttt
tacaaagaaaaaattagtgtcattggtaacggtatggttgtggatccaaaagctttagtg
gaggaattaaaatatcttcatgacaaaggcgtggatacttctaatttgcgtatttctaac
cgtgcgcacattattttaccatatcacattcgtattgatgaagctgacgaagaacgtaag
ggcgcaaacaaaatcggtacaacgaaaaaaggtattggcccagcttacatggataaagca
gcgcgtgtaggtattcgtattattgatttattagataaagaaacatttaaagagaaatta
gagcataatcttggcgagaaaaaccgtttattagaacgtttttacgaactagaaggcttt
aaactagaagatattttagaagaatattatgactatggtcaacaatttaaagaatatgtt
tgcgatacatctgttgttttaaatgacgcattagatgatggtaaacgtgtattatttgaa
ggtgcgcaaggggttatgcttgatattgatcaaggaacatatccatttgtaacttcaagt
aacccgattgctggtggcgtaactatcggtagtggcgtaggtccttcaaaaatcaatcat
gttgttggtgtggcgaaagcttatacaacacgtgttggtgatggtcctttcccaacagaa
ttattcgatactattggggacactatccgtgaggttggtcatgagtatggtacaacgact
ggtcgtccgcgccgtgtaggttggtttgacagtgtagtggttcgccatgcgcgtcgtgtt
agtggcttaacagatttatcgttaacactactggatgttttgacaggaattgaaacactt
aaaatctgcgtagcttacaaattagacggaaaaacaattacagagttcccggcaagtctg
aaagatctagctcgttgcgaacctgtatatgaagaacttccaggctggacggaagatatt
actggagttacatcactcgatgatcttccggtgaactgccgccattacatggagcgtatt
gcacagctaactggtgtgcaggtttctatgttctctgtaggccctgatcgcgctcaaaca
catgtcattaaaagcgtttggcgtttagcttaa

DBGET integrated database retrieval system