KEGG   Listeria monocytogenes serotype 4b LL195: BN389_01900Help
Entry
BN389_01900       CDS       T02416                                 

Gene name
metG
Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
lmog00450  Selenocompound metabolism
lmog00970  Aminoacyl-tRNA biosynthesis
lmog01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmog00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BN389_01900 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN389_01900 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lmog01007]
    BN389_01900 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lmog03016]
    BN389_01900 (metG)
Enzymes [BR:lmog01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BN389_01900 (metG)
Amino acid related enzymes [BR:lmog01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BN389_01900 (metG)
Transfer RNA biogenesis [BR:lmog03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BN389_01900 (metG)
 Prokaryotic type
   Other AARSs
    BN389_01900 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f ARL2_Bind_BART DUF2724
Motif
Other DBs
NCBI-ProteinID: CCO62764
UniProt: A0A0E1R2M7
Position
181227..183119
Genome map
AA seq 630 aa AA seqDB search
MARYKRLKGYDVFYLTGTDEHGQKIQAKAKERGISEQEYVDEIAEGFQELWKKLEISNTD
FIRTTQDRHKTSVEKIFEQLLEQGDIYLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVI
GGKAPSGNEVELVKEESYFFRMSKYADRLVEYYNSHPEFILPESRKNEMINNFIKPGLED
LAVSRTTFDWGIKVPGNPKHVVYVWIDALSNYITALGYNTDNDTKFQKYWPADVQIVGKE
IVRFHTIYWPIMLMALDLPLPKMVFGHGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALR
YYLLREVPFGSDGLFTPEDFVDRVNFDLANDLGNLLNRTVAMINKYFDGEIPAYQGNVTE
FDQTLVDFKNNVVKEYEGSMDHMQFSVALNQLWSLISRTNKYIDETAPWTLAKDEDKRTE
LASVMTHLAENLRIIAVLLQPFLTRTPGEIFLQLGLQEENLKKWDSIYGYGEIPAGTTVV
KKGTPIFPRLEAEVEVTYIQDEMKGSAPAPAKEAAEVEALETPQIGIEDFDKIDLRVAEV
KQVDKVKKADKLLCFQLDLGEGKLRQVLSGIAEFYQPEELIGKKVIVVSNLKPVKLRGLM
SEGMILSGEKDGKLSVIEASSALPNGAKVK
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggctcgttataaacgcttaaaaggatatgatgtgttttacttaactggaacagatgag
cacggtcaaaaaatccaagcaaaagcgaaagaacgcggaatttctgaacaagaatacgtg
gatgaaatcgcagaaggtttccaagaactttggaaaaaactagaaatttctaatacggat
tttattcgtacaacacaagaccgtcataaaacatcggttgaaaaaatctttgaacaactt
ttagaacaaggcgacatttacttaggtgaatacgaaggttggtactctgtttctgatgaa
gaatactttacagaaacacagttagaagaagtatataaagatgaaaatggtaaagtaatc
ggcggaaaagccccaagtggcaatgaagtcgaactagtgaaagaagaatcctacttcttc
cgtatgagcaaatatgcggaccgtttagtagaatattataattcccatccagaatttatc
cttcctgaatctagaaaaaatgaaatgattaataatttcatcaaacctggtttggaagat
ttagctgtatctagaacaacttttgattggggtattaaagttcctggcaatccaaaacac
gttgtttatgtatggattgacgcgctttctaactatattactgcgcttgggtataatacg
gacaatgacacgaaattccaaaaatactggcctgctgatgtacaaatcgttgggaaagaa
atcgttcgtttccacacgatttattggccaattatgctgatggcactagacttaccactt
ccaaaaatggtgttcggccacggctggattctaatgaaagatggtaaaatgtctaaatcc
aaagggaatgtagtagatccttatatgctgattgaccgctacggcctagatgcgcttcgt
tattacttattacgcgaagttccatttggttcagatggtttatttacaccggaagacttt
gttgatcgtgtgaactttgatcttgccaacgatttaggaaacttacttaatcgtacagta
gcaatgattaataagtactttgatggcgaaattccggcttatcaaggcaatgtaacagaa
ttcgatcaaaccttagtggatttcaaaaacaatgtggtgaaggaatatgaaggtagcatg
gatcacatgcaattctctgtagctttaaaccaactgtggtcactaatttctcgtacaaat
aaatatatcgatgaaaccgctccatggacacttgccaaagacgaagataaacgcacagaa
cttgcgagcgtaatgactcatttagcagaaaacttacgtattatcgcagtacttttgcaa
ccattcttaacaagaactccaggcgaaatcttcttacaactaggtttacaagaagaaaac
ttgaaaaaatgggatagcatctatggatacggtgaaattccagctggcacaacagtggtg
aaaaaaggtacgccaattttcccaagacttgaggcagaagtagaagttacttatatccaa
gatgaaatgaaaggctctgcgccagctcctgccaaagaagcggcggaagttgaagcactt
gaaacaccgcaaatcggcattgaagatttcgataaaatcgatcttcgtgttgcagaagta
aaacaagtagataaagtgaaaaaagcagataaacttctttgtttccaattagacttaggg
gaaggaaaactgcgccaagtgctttcaggcattgcagaattctatcaaccagaagaacta
atcggcaaaaaagttatcgtcgtttctaacttaaaacctgtaaaacttcgcggactaatg
agtgaaggaatgatactctcaggcgaaaaagatggtaagctaagtgtaatcgaagcaagt
agcgcacttccaaatggtgcaaaagtaaaatag

DBGET integrated database retrieval system