KEGG   Listeria monocytogenes serotype 4b LL195: BN389_14400Help
Entry
BN389_14400       CDS       T02416                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
lmog00071  Fatty acid degradation
lmog00072  Synthesis and degradation of ketone bodies
lmog00280  Valine, leucine and isoleucine degradation
lmog00310  Lysine degradation
lmog00362  Benzoate degradation
lmog00380  Tryptophan metabolism
lmog00620  Pyruvate metabolism
lmog00630  Glyoxylate and dicarboxylate metabolism
lmog00640  Propanoate metabolism
lmog00650  Butanoate metabolism
lmog00900  Terpenoid backbone biosynthesis
lmog01100  Metabolic pathways
lmog01110  Biosynthesis of secondary metabolites
lmog01120  Microbial metabolism in diverse environments
lmog01130  Biosynthesis of antibiotics
lmog01200  Carbon metabolism
lmog01212  Fatty acid metabolism
lmog02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmog00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN389_14400 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    BN389_14400 (thlA)
   00640 Propanoate metabolism
    BN389_14400 (thlA)
   00650 Butanoate metabolism
    BN389_14400 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN389_14400 (thlA)
   00072 Synthesis and degradation of ketone bodies
    BN389_14400 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN389_14400 (thlA)
   00310 Lysine degradation
    BN389_14400 (thlA)
   00380 Tryptophan metabolism
    BN389_14400 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN389_14400 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN389_14400 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN389_14400 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmog04147]
    BN389_14400 (thlA)
Enzymes [BR:lmog01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN389_14400 (thlA)
Exosome [BR:lmog04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN389_14400 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CCO64014
UniProt: A0A0E1R677
Position
complement(1423574..1424749)
Genome map
AA seq 391 aa AA seqDB search
MAMKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQ
AGLGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENM
SQAPLLLNPELAGEEIDPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEF
AHNSQMKAANAQEKNLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTV
TAGNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALT
KGGYSIDDIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASL
LNELKHENKHIGVASLCVGGGIGIAIILEKA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
attgctatgaaagaagtagttataatagatgcagttagaacaccaattggaaaatttggt
ggtagtttgaaagacatcagtgcagtagaccttggcgctaccgctctaaaaggtgtttta
gaaagagccaatattgctccagaacgggtggatcaagtgatttttggtaatgtattacaa
gctggacttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaa
gtacccggagtcacaatcaatgaagtttgtggatctggcttaaaatcggttatgcttggt
aggcaagcaattcagctaggggaggctgacatcgtagccgttggtgggaccgaaaatatg
tcccaagcaccacttttacttaatcccgagctagctggcgaagaaatcgatccaaaaaaa
ctaagaaatagcatgttaattgatggtttaacagatgtttacggcgagtatcacatggga
attactgcagaaaatgttgcagagaaattctccgtaaccagagaagaacaagatgaattt
gcccataactcacaaatgaaggccgcgaatgcacaagaaaaaaacctttttgaagaggaa
attattcctgtaaagcttccagacggttcattttttgaagccgatgaaacgattcgcgcg
aattcaactctagaaaaattagctactttgaaaagcgtattcaaagaaggtggaacggtt
acagccggcaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaa
gaaaaggcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaagtt
ggtgtcgatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaact
aaaggtggatattctatcgatgacattgatttattccatttaaacgaagcttttgcatcg
cagtcagttgcagtggctcgtgatttaaaaattccagaagagaaacttaatatttacggt
ggagcaattgcactaggccatccaattggagcttctggtgcacgcattattgcctcattg
ttaaatgagttaaaacatgaaaataagcacatcggtgtcgcttccttgtgtgttggtggt
ggtattggtattgcaattatccttgaaaaagcttga

DBGET integrated database retrieval system