KEGG   Luteipulveratus mongoliensis: VV02_04600Help
Entry
VV02_04600        CDS       T04024                                 

Definition
(GenBank) hypothetical protein
  KO
K16050  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase [EC:3.7.1.17]
Organism
lmoi  Luteipulveratus mongoliensis
Pathway
lmoi00984  Steroid degradation
lmoi01100  Metabolic pathways
lmoi01120  Microbial metabolism in diverse environments
lmoi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lmoi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    VV02_04600
Enzymes [BR:lmoi01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.17  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
     VV02_04600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DUF3995 Abhydrolase_4 Ndr DUF2374 Esterase
Motif
Other DBs
NCBI-ProteinID: AKU15309
UniProt: A0A0K1JF28
Position
981626..983065
Genome map
AA seq 479 aa AA seqDB search
MTTISPAAPAVRTATSPQRTLPRSALFIASVLALDGLCHAVWATGLTWPASDEHHLSLAV
LGFATSFGPGVVLPLAALLWTAAGLVVARGWLGRDHRFGWLWQLATLAVTIGVATRAAFG
VVWAVVGFGAMPTVFAWINALAYTPLCMVMAVCGWRLLGAGRAGRRVWGRAVAAVVPALL
VCGTLTAAYGFPPKTQPYDPQRALGAVESRYVETPVARFHYLKEGSGTPVVLLSPGASWV
NSWLPQLEALKATHTVYVVDLPGQGFTSLKDHDFAFTLDGMTGAVDSFLDAVGVKSAALA
GNSWSGGWATAYAQRHPERVSSLMLLAPTVLDEPDPTSWEMLKLPVVGRALTNLTVGSRS
MTESAVRALFVHRERAAPELVDGFWAAGTRPDNVRSMYELEAGLDWSVTERALPRTTQPT
LVIWGRQDTVVPVAQARELGVRLPQAQVHVLDQCGHALTLDCPDQVDALMTGFLRARQQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgatctcgcccgccgcgccggctgtccgaaccgctacctcgccgcagcgcacc
ctgcctcggtccgcgctcttcatcgcatccgtgctcgcgctcgacgggttgtgtcacgcg
gtctgggcgaccgggctgacctggccggcgagcgacgagcatcacctatcgctcgccgta
ctcgggttcgcgacgtcgttcgggccgggtgtcgtcctgccgctggcggcgctgctctgg
acggccgcgggcctggtggtcgcgcgaggttggttgggtcgtgaccaccggttcgggtgg
ctgtggcagctcgcgacgctggcggtgaccatcggcgtggccacccgagcggcgttcggc
gtggtctgggcagtcgtcgggtttggcgcgatgccaacggttttcgcgtggatcaacgcc
ctggcttacacaccgctctgcatggtgatggccgtctgcgggtggcgacttcttggagcc
ggccgcgcggggaggcgcgtgtggggcagggcggtagcggccgtcgtaccggccctgctc
gtgtgcggaaccctcactgctgcttacggattccctccgaagacgcagccgtacgaccct
cagcgggcgctcggtgcggtggagtcacggtacgtcgagacgccggtcgcgcggttccac
tacctcaaggagggctcgggtacgccggtcgtgctgctctccccgggcgcgtcctgggtg
aactcctggctgccgcagctggaggcgctcaaggcgacgcacacggtctatgtggtcgac
ctccctgggcaaggtttcacctcactgaaggaccacgacttcgccttcaccctcgatggg
atgaccggtgcggtggactcgtttctcgacgctgttggcgtgaaaagcgctgcgcttgct
ggtaactcgtggagtggcggatgggcgacggcatacgcgcagcgtcatccggagagagtc
agcagcctgatgctcctcgctccgactgtgctcgatgagcccgatccgaccagctgggag
atgctcaagctgcccgtggttgggcgcgcgctgaccaacctgacggtcgggtcgcgcagc
atgacggagtccgccgtgcgcgcgctcttcgtgcaccgcgagcgggccgcgccggagctg
gtcgacggcttctgggcggctgggacgcggcccgacaacgtgcgctcgatgtacgagctg
gaggcgggactcgactggtccgtcaccgagcgggcgctgccgcgtacgacgcagccgacg
ctggtgatctgggggcggcaggacacggtggtgccggtcgcgcaggcacgcgagctcggc
gtacggctcccgcaggctcaggtgcacgtgctcgaccagtgcggccacgccctcacgctc
gactgcccggaccaggtcgatgcgctgatgacaggattcctgcgtgctcgacagcagtga

DBGET integrated database retrieval system