KEGG   Luteipulveratus mongoliensis: VV02_05075Help
Entry
VV02_05075        CDS       T04024                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lmoi  Luteipulveratus mongoliensis
Pathway
lmoi00480  Glutathione metabolism
lmoi00590  Arachidonic acid metabolism
lmoi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmoi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    VV02_05075
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VV02_05075
Enzymes [BR:lmoi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     VV02_05075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AKU15384
UniProt: A0A0K1JF93
Position
1075961..1076461
Genome map
AA seq 166 aa AA seqDB search
MSLYDIPLKSLEDQPTTLGAYAGRALLVVNVASKCGLTPQYGGLERLQEKYADRGLTVVG
FPCNQFGGQEPGSAEEIQTFCSTSYGVTFPLMEKVDVNGDDRHPVYQELTQTKDADGEAG
DIQWNFEKFLISPAGEVVARFRPTTEPEAAEVTAAIEANLPSPLVE
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctctacgacattcctctcaagtccctcgaagaccagccgacgaccctcggtgcg
tacgccggtcgcgcgcttctcgtcgtcaacgtcgcctccaagtgtgggctgactccgcag
tacggcggcctcgagcggctgcaggagaagtacgccgaccgcgggctgaccgtcgtcggt
ttcccctgcaaccagttcggtgggcaggagccgggcagcgcggaggagatccagacgttc
tgctcgacgagctatggcgtgacgttcccgctgatggagaaggtcgatgtgaacggcgac
gaccggcacccggtctaccaggagctgacgcagaccaaggacgctgacggcgaggccggc
gacatccagtggaacttcgagaagttcctgatctcgcccgccggtgaggtcgtggcgcgc
ttccgtccgacgaccgagcccgaggccgccgaggtcaccgccgccatcgaggccaacctc
ccatcaccgctggtcgagtag

DBGET integrated database retrieval system