KEGG   Luteipulveratus mongoliensis: VV02_14585Help
Entry
VV02_14585        CDS       T04024                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
lmoi  Luteipulveratus mongoliensis
Pathway
lmoi00030  Pentose phosphate pathway
lmoi00480  Glutathione metabolism
lmoi01100  Metabolic pathways
lmoi01110  Biosynthesis of secondary metabolites
lmoi01120  Microbial metabolism in diverse environments
lmoi01130  Biosynthesis of antibiotics
lmoi01200  Carbon metabolism
Module
lmoi_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
lmoi_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:lmoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VV02_14585
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VV02_14585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmoi04147]
    VV02_14585
Enzymes [BR:lmoi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     VV02_14585
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     VV02_14585
Exosome [BR:lmoi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   VV02_14585
  Exosomal proteins of colorectal cancer cells
   VV02_14585
  Exosomal proteins of bladder cancer cells
   VV02_14585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AKU16809
UniProt: A0A0K1JJB6
Position
complement(3053101..3054645)
Genome map
AA seq 514 aa AA seqDB search
MSPARVARGVNPLRQVEDKRLPRIAGPCGMVLFGVTGDLARKKLMPAIYDLSNRGLLPPG
FSLVGFARRDWEDQDFGKIVYEAVREHARTPFREEVWRNLAEGFRFVPGTFDDPAAFDLL
AETVKELDESRGTGGNHAFYLSIPPAFFSVVCEQLERSGLSKPGPGQWRRVVIEKPFGHD
LKSARELNAIVESVFPADSVFRIDHYLGKETVQNILALRFANQLFEPVWNSHYVDHVQIT
MAEDIGIAGRAGYYDGIGAARDVIQNHLLQLMALTAMEQPNSFEASDLRTEKEKVLAAVR
LPKDLAKSSARGQYAAGWQGSEKVIGYLDEDGISPRSSTETYAALKLEVHTRRWAGVPFY
LRTGKRLGKRVTEIAVVFKRAPHLPFTDTATEELGQNAIVIRVQPDEGITMRFGSKVPGA
GSMEVRDVTMDFGYGSAFTESSPEAYERLILDVLLGDPPLFPRHEEVELSWQILDPVEKF
WSRNGRPLPYDSGGWGPDNADEMMRRDGRTWRMP
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccagcccgcgtcgctcgcggggtcaacccgctccgacaggtcgaggacaagcga
ctgccccgcatcgccggcccgtgcggcatggtgctgttcggcgtcaccggagacctcgcg
cgcaagaagctcatgccggcgatctacgacctgtccaaccgggggctgctgccgccgggc
ttctcactcgtcgggttcgcacggcgtgactgggaggaccaggacttcggcaagatcgtc
tacgaggcggtgcgcgagcacgcccgtacgccattccgcgaggaggtgtggcgcaacctg
gccgagggattccgtttcgtaccaggcacattcgacgacccggccgccttcgacctgctg
gcggagaccgtcaaggagctcgacgagtcacgcggcaccggcggcaaccacgcgttctac
ctgtccatcccgcccgcgttcttctcggtcgtgtgcgagcagctcgaacgcagcggactg
tccaagcccgggcccggccagtggcgccgggtggtcatcgagaagccgttcggacacgac
ctcaagagcgcccgcgagctcaacgcgatcgtcgagagcgtctttcctgccgactcggtc
ttccggatcgatcactacctcggcaaggagaccgtccagaacatcttggcgctgcgcttt
gccaaccagctgttcgagccggtctggaactcccactacgtcgaccacgtgcagatcacg
atggccgaggacatcggcatcgccggtcgcgccggctactacgacggcatcggcgccgcg
cgcgacgtgatccagaaccacctgctccagctcatggcgctgaccgccatggagcagccc
aactccttcgaggcctcagatctgcggaccgagaaggagaaggtgctcgccgccgtacga
ctgccgaaggatctggccaagtccagcgcccgagggcagtacgccgcaggctggcagggc
agcgagaaggtcatcggctacctcgatgaggacggcatcagcccgcgctcctccaccgag
acgtacgccgccctcaagctcgaggtgcacactcgccggtgggcaggggtgccgttctac
ctgcgtacgggcaagcggctcggcaaacgcgtcaccgagatcgcggtggtgttcaaacgc
gcgccgcacctgccgttcaccgacaccgcgaccgaagaactcggtcagaacgccatcgtg
atccgcgtccagccggacgaaggcatcacgatgcggttcggctccaaggtgccaggcgcg
gggtcgatggaggtgcgggacgtgacgatggacttcggctacggcagcgccttcaccgag
tcgagcccggaggcctacgagcgcctcattctcgatgtgctgctcggcgacccgccgctg
ttcccgcggcacgaagaggtcgagctgtcgtggcagatcctcgacccggtcgagaagttc
tggtcacgcaacggtcgaccactcccctatgactccggcgggtggggcccggacaacgcc
gacgagatgatgcgccgcgacggccggacctggaggatgccttga

DBGET integrated database retrieval system