KEGG   Luteipulveratus mongoliensis: VV02_21130Help
Entry
VV02_21130        CDS       T04024                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lmoi  Luteipulveratus mongoliensis
Pathway
lmoi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lmoi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    VV02_21130
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lmoi03011]
    VV02_21130
Ribosome [BR:lmoi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    VV02_21130
  Bacteria
    VV02_21130
  Archaea
    VV02_21130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AKU17771
UniProt: A0A0K1JM37
Position
complement(4433905..4434273)
Genome map
AA seq 122 aa AA seqDB search
MEAKAQARFVRVTPQKARRVVDLIRGKQASEAVAVLQFAPQTASEPIRKVLESAIANARF
AADKAAQPFDERELFVSAAYVDEGPTMKRFRPRAQGRASRILKRTSHITVHVAQPSSKGG
QN
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggaagccaaggcgcaggcgcggttcgtccgtgtgacgccgcagaaggcccgccgcgtt
gtggacctcatccgtggcaagcaggcctctgaggccgtcgccgtgctgcagttcgctccg
cagaccgcgagcgagccgatccgcaaggtgctcgagagcgccattgccaacgcccgtttc
gcagccgacaaggcggcgcagccgttcgacgagcgcgagctcttcgtcagcgccgcctac
gtcgacgagggcccgaccatgaagcggttccgcccccgggcgcagggccgcgcgagtcga
atcctcaagcgtacgagccacatcaccgtgcatgtcgcccagcccagctccaagggaggc
cagaactaa

DBGET integrated database retrieval system