KEGG   Luteipulveratus mongoliensis: VV02_22520Help
Entry
VV02_22520        CDS       T04024                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
lmoi  Luteipulveratus mongoliensis
Pathway
lmoi00860  Porphyrin and chlorophyll metabolism
lmoi01100  Metabolic pathways
lmoi01110  Biosynthesis of secondary metabolites
lmoi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmoi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VV02_22520
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lmoi01007]
    VV02_22520
Enzymes [BR:lmoi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     VV02_22520
Amino acid related enzymes [BR:lmoi01007]
 Aminotransferase (transaminase)
  Class III
   VV02_22520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKU19208
UniProt: A0A0K1JRK8
Position
complement(4715637..4716998)
Genome map
AA seq 453 aa AA seqDB search
MASSSTTSRSTSAGSSSSTARSAALIERARSVTPGGVNSPVRAFRAVGGTPRFIASAEGP
WLTDVDGNRYVDLICSWGPMILGHRHPSVLSAVTEAAGKGFSFGTPSENEVALASEIVDR
VEPLEQVRLVSSGTEATMSALRLARGATGRSKVVKFAGCYHGHVDALLASAGSGLATFAL
PDSAGVPDSSAGETIVLPYNDVAAVEAAFAEHGDEIACVITEASPGNMGVVPPEPGLTEA
LRRITRAHGALLISDEVMTGFRCSASGWYGLEGPYDGGAPDLFTFGKVMGGGFPAAAFGG
RADLMGHLAPDGPVYQAGTLSGNPVATAAGLATLKGCTPEVYARLDTVAHSIADAAHTEL
SAAGVPHTIQWAGSMFSVFFREGAVRTYDDAKSQDTAAFSRFFNAMLDQGVHLPPSAYEA
WFVSASHNDDAVEAVLQALPAAARAASETHGSL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctcctccactacgtctcgtagtacttctgctgggtcgagctcatcgaccgcc
cgctctgccgcactgatcgagcgggcgcgcagcgtcactcctgggggcgtcaacagcccc
gtccgtgccttccgcgccgtgggcggcaccccgcgattcatcgcctccgccgaaggcccg
tggctgaccgatgtggacggcaaccgttacgtcgatctcatctgctcctggggcccgatg
atcctcggccaccgccatccgtcggtcctctccgcagtcacagaggcggccggcaagggc
ttctcgttcgggacgccgagtgagaacgaggtcgcgctggcctccgagatcgtcgaccgc
gtcgagccgctcgagcaggtgcgcctggtcagcagcgggaccgaggcgacgatgagcgcc
ctgcgtctggctcgcggggcgaccggacggtccaaggtcgtgaagttcgccggttgctac
cacggtcacgtcgacgcgctgctcgccagcgcgggcagcggcctggcgacgttcgccctg
ccggactcggccggcgtacccgactccagcgccggggagacgatcgtgctcccgtacaac
gacgtcgccgcggtggaagccgcgtttgccgagcacggtgacgagatcgcgtgcgtgatc
accgaggcctcgcccggcaacatgggcgtcgtcccgccggagccaggtctcaccgaggcg
ctgcgtcgcatcacccgcgcgcacggtgcgctgctgatcagcgacgaggtcatgacgggc
ttccgctgctcggcctcgggctggtacggcctcgagggtccgtacgacggtggggcacct
gacctcttcaccttcggcaaggtcatgggcggcggcttcccggccgccgcgttcggcgga
cgtgcggacctgatgggccacctcgcgccggacggcccggtctaccaggccggcacgctg
tccgggaaccccgtcgccacggccgccggactggccacgctcaagggctgcacccccgag
gtctacgcccgcctcgacaccgtcgctcacagcatcgccgacgccgcgcacaccgagctg
agcgcggccggcgtaccccacacgatccagtgggccggctcgatgttcagcgtgttcttc
cgcgagggcgcggtgcggacgtacgacgacgccaagtcccaggacaccgccgccttctcg
cggttcttcaacgcgatgctggaccagggtgtgcacctgccgccgagcgcgtacgaggcg
tggttcgtgagcgcgtcacacaacgatgatgcagtcgaggcggtcctgcaggcgctcccc
gctgctgccagggcggcctcagaaacgcatgggagtctctga

DBGET integrated database retrieval system