KEGG   Luteipulveratus mongoliensis: VV02_24620Help
Entry
VV02_24620        CDS       T04024                                 

Definition
(GenBank) ribosomal RNA large subunit methyltransferase J
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
lmoi  Luteipulveratus mongoliensis
Brite
KEGG Orthology (KO) [BR:lmoi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lmoi03009]
    VV02_24620
Enzymes [BR:lmoi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     VV02_24620
Ribosome biogenesis [BR:lmoi03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    VV02_24620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsJ Methyltransf_24 Methyltransf_23 DUF4537 Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AKU18282
UniProt: A0A0K1JNJ7
Position
5144989..5146002
Genome map
AA seq 337 aa AA seqDB search
MLFSVAPDYYRSAVAELRRTLPVAKIQRVGEDAGIVYLGSGGQETAVEASMACDLRFVRH
LAGVDAVVNTSELNRLDAEEVADWAADAVLDRLDAGDEVSLHVWDSGDVSWAPGKIRRPL
LEVLLDNGIRVVTSNSEQTVSVCVGEERTTVGLSPSGLGLCDWAGGRIRLANRKEQVSRA
EFKLEELFGFIGPPSGKVAIDLGASPGGWTRILRSHGFERVYSVDPADLDPRILADDEVH
HHRTTAGEFIAAYKDSPVDMIVNDMRMVPHMTAITMVDAADILRPGGQVVVTFKLGTTNP
VKQADESLETLAEAYEPTFIRQLQHNRHELTVVATRR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgctcttctcggtagcgcccgactactaccgctctgcggtcgccgagctgcgtcgtacg
ctgccggtcgccaagatccagcgcgtcggcgaggacgccggcatcgtctacctcggcagc
ggcggacaggagaccgcggtcgaggccagcatggcgtgcgacctgcgcttcgtccgccat
ctcgccggcgtcgacgcagtcgtcaacacttccgagctgaaccggctcgacgcggaagag
gtcgcggactgggcggctgatgcggtgctcgatcgcctggacgccggcgacgaagtcagt
ctccacgtctgggacagcggcgatgtctcgtgggcccccggcaagatccgtcgtccgctg
ctggaagtgttgctggacaacgggattcgcgtggtcacgtccaactccgagcagacggtt
tcggtgtgcgtgggtgaggagcgtacgacggtgggcctcagccccagcggtctcggcctc
tgcgactgggccggtggtcgcatccgactcgccaaccgcaaggagcaggtctctcgggcg
gagttcaagctggaggagctgttcgggttcatcggtccgccgtccggcaaggtcgcgatc
gacctcggcgcgagcccgggcgggtggacgcgcatcctgcgcagccacggcttcgagcgg
gtctactccgtcgaccccgccgacctcgacccgcgcatcctggccgacgacgaggtgcat
caccaccgcaccacggccggcgagttcatcgcggcctacaaggacagcccggtcgacatg
atcgtcaacgacatgcggatggtgccgcacatgaccgcaatcacgatggtcgacgccgcc
gacatcctgcgtccgggtgggcaggtggtggtgacgttcaagctcggcaccaccaacccg
gtcaagcaggccgacgagtcactcgagactctcgctgaggcgtacgagccgacgttcatc
cggcagctccagcacaaccggcacgagctgaccgtcgtcgccacccgccgctga

DBGET integrated database retrieval system