KEGG   Listeria monocytogenes J1816: LM220_07892Help
Entry
LM220_07892       CDS       T02776                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmoj  Listeria monocytogenes J1816
Pathway
lmoj00071  Fatty acid degradation
lmoj00072  Synthesis and degradation of ketone bodies
lmoj00280  Valine, leucine and isoleucine degradation
lmoj00310  Lysine degradation
lmoj00362  Benzoate degradation
lmoj00380  Tryptophan metabolism
lmoj00620  Pyruvate metabolism
lmoj00630  Glyoxylate and dicarboxylate metabolism
lmoj00640  Propanoate metabolism
lmoj00650  Butanoate metabolism
lmoj00900  Terpenoid backbone biosynthesis
lmoj01100  Metabolic pathways
lmoj01110  Biosynthesis of secondary metabolites
lmoj01120  Microbial metabolism in diverse environments
lmoj01130  Biosynthesis of antibiotics
lmoj01200  Carbon metabolism
lmoj01212  Fatty acid metabolism
lmoj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmoj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LM220_07892
   00630 Glyoxylate and dicarboxylate metabolism
    LM220_07892
   00640 Propanoate metabolism
    LM220_07892
   00650 Butanoate metabolism
    LM220_07892
  Lipid metabolism
   00071 Fatty acid degradation
    LM220_07892
   00072 Synthesis and degradation of ketone bodies
    LM220_07892
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LM220_07892
   00310 Lysine degradation
    LM220_07892
   00380 Tryptophan metabolism
    LM220_07892
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LM220_07892
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LM220_07892
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LM220_07892
Enzymes [BR:lmoj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LM220_07892
Exosome [BR:lmoj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LM220_07892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: EGF45805
Position
2650688..2651857
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEIDPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAANAQEKNLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDDIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILEKA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaatttggtggtagt
ttgaaagacatcagtgcagtagaccttggcgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgggtggatcaagtgatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtttgtggatctggcttaaaatcggttatgcttggtaggcaa
gcaattcagctaggggaggctgacatcgtagccgttggtgggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagctggcgaagaaatcgatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgagtatcacatgggaattact
gcagaaaatgttgcagagaaattctccgtaaccagagaagaacaagatgaatttgcccat
aactcacaaatgaaggccgcgaatgcacaagaaaaaaacctttttgaagaggaaattatt
cctgtaaagcttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctactttgaaaagcgtattcaaagaaggtggaacggttacagcc
ggcaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaagttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgacattgatttattccatttaaacgaagcttttgcatcgcagtca
gttgcagtggctcgtgatttaaaaattccagaagagaaacttaatatttacggtggagca
attgcactaggccatccaattggagcttctggtgcacgcattattgcctcattgttaaat
gagttaaaacatgaaaataagcacatcggtgtcgcttccttgtgtgttggtggtggtatt
ggtattgcaattatccttgaaaaagcttga

DBGET integrated database retrieval system