KEGG   Listeria monocytogenes J1816 (serotype 4b): LM220_12037Help
Entry
LM220_12037       CDS       T02776                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
lmoj  Listeria monocytogenes J1816 (serotype 4b)
Pathway
lmoj00860  Porphyrin and chlorophyll metabolism
lmoj01100  Metabolic pathways
lmoj01110  Biosynthesis of secondary metabolites
lmoj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmoj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LM220_12037
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lmoj01007]
    LM220_12037
Enzymes [BR:lmoj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     LM220_12037
Amino acid related enzymes [BR:lmoj01007]
 Aminotransferase (transaminase)
  Class III
   LM220_12037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: EGF45710
Position
2505274..2506563
Genome map
AA seq 429 aa AA seqDB search
MQNYSKSEKAFKEAKKVLPGGVNSPVRAFNSVDASPVFMDHGKGAYITDVDGNEYIDYVL
SWGPLILGHADPAVVNAITKAALKGTSFGTPTEIETELAKLVIERVPSIEIVRMVSSGTE
ATMSAIRLARGYTKREKILKFEGSYHGHGDSLLIKAGSGVATLGLPDSPGVTKGLAADTI
TVPYNDIEGAELAFQKYGEEIAAVIVEPVAGNMGVVPPIDGFLEGLRELTTKFGSLLIFD
EVMTGFRVDYYSAQGYYVVTPDLTCLGKVIGGGLPVGAYGGKKEIMEQIAPAGSIYQAGT
LSGNPLAMNAGFETVRQLTPQHYDVFRTLIKRMEEGLTEISARRQVPLSINKAGSMFGFF
FTDQKVINFDTAKTSNLEFFRNYYREMLGQGIFLPPSQFEGVFISTMHTEKEIDKTLEAF
DTTCKILRG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaactattcgaaatccgaaaaggcctttaaagaagccaaaaaagtcttacctggt
ggtgtaaatagccctgttcgagcattcaactctgtagatgcctcgccagtttttatggac
cacggaaaaggcgcttatattacagatgttgatggtaacgaatatattgattatgtgtta
tcttggggccctctaattttagggcacgctgatccagctgttgttaatgctattacaaaa
gcagctctgaaaggtaccagctttgggacgcctactgagattgaaactgaattagcaaaa
ttagtaattgaacgtgtgccatctattgaaattgttcgtatggtttcatcaggaacggaa
gcaacgatgagtgctattcgtttggctcgcggttatacaaaaagagaaaaaatcttgaaa
tttgaaggaagttatcacggacatggagattctttattaattaaagctggttcaggggta
gcaacactcggattaccggattctccaggagttactaaaggtcttgcggcagatacaata
acagtcccatacaatgatattgaaggagccgaactggccttccaaaaatatggagaagaa
atagcagcagtcatagttgaaccagtcgcgggcaatatgggtgttgttcctccaattgat
ggatttttagaaggacttcgagagcttactacaaaatttggctccttgctcatttttgat
gaagttatgaccggatttagagtagattactattctgctcaaggctattatgtggtaacg
cccgatcttacttgtttaggaaaagtgattggtggtggtttaccagttggtgcttatggt
ggaaagaaagaaattatggaacagattgctcctgctggttctatttatcaagcgggaact
ttatccggaaatccattagcaatgaatgctggctttgaaacagttcgccaactaacgccg
caacactatgatgttttccgcaccctaattaagcgaatggaagaaggacttacagagata
tctgctagaagacaagtcccgctctcgattaataaggctggttcgatgttcggctttttc
ttcactgatcaaaaagtgattaattttgatacagcaaaaacaagtaatctagaatttttc
cgaaattattaccgtgaaatgttaggtcaaggcattttcttaccaccgtctcagtttgag
ggtgtcttcatttctacgatgcacaccgagaaagaaattgataagaccttggaagcattt
gatacgacatgcaaaatacttcgcggctaa

DBGET integrated database retrieval system