KEGG   Listeria monocytogenes J1816 (serotype 4b): LM220_20240Help
Entry
LM220_20240       CDS       T02776                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
lmoj  Listeria monocytogenes J1816 (serotype 4b)
Pathway
lmoj00230  Purine metabolism
lmoj00240  Pyrimidine metabolism
lmoj01100  Metabolic pathways
lmoj01110  Biosynthesis of secondary metabolites
lmoj01130  Biosynthesis of antibiotics
Module
lmoj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
lmoj_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
lmoj_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:lmoj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LM220_20240
   00240 Pyrimidine metabolism
    LM220_20240
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lmoj04131]
    LM220_20240
Enzymes [BR:lmoj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     LM220_20240
Membrane trafficking [BR:lmoj04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    LM220_20240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AGR32864
Position
2091354..2091797
Genome map
AA seq 147 aa AA seqDB search
MEQTYVMVKPDGVERGLIGEIVTRIEKKGLKIVAGKLMQIDRELAEKHYAEHIGKSFFED
LIGFITSGPVFAMVLEGDDAIATARRMMGKTNPLEADPGTIRADYAVHTNRNVIHGSDSP
ESAKREIQLFFAPQEILSYQKAIDTWI
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaacttatgtaatggttaagccggatggtgtagaacgaggacttattggtgaa
attgtcacaagaatagagaaaaaaggcttaaaaatagttgctggaaaattaatgcaaatt
gaccgtgaactagcagaaaaacattacgcggaacatattggaaaatcttttttcgaggat
ttaattggatttattacttctggaccagtgtttgcgatggtgttagaaggagatgatgcg
attgcaacagctcgccgtatgatgggcaaaacaaatccgttagaagctgaccccggaaca
attcgcgctgattatgcggtacatacaaatcgaaatgtgattcatggatcggatagccca
gaaagtgcgaaacgggaaattcagttgttttttgcaccgcaggaaattttaagttatcaa
aaggcaatcgacacttggatttaa

DBGET integrated database retrieval system