KEGG   Listeria monocytogenes NE dc2014: CQ02_07265Help
Entry
CQ02_07265        CDS       T03477                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmok  Listeria monocytogenes NE dc2014
Pathway
lmok00071  Fatty acid degradation
lmok00072  Synthesis and degradation of ketone bodies
lmok00280  Valine, leucine and isoleucine degradation
lmok00310  Lysine degradation
lmok00362  Benzoate degradation
lmok00380  Tryptophan metabolism
lmok00620  Pyruvate metabolism
lmok00630  Glyoxylate and dicarboxylate metabolism
lmok00640  Propanoate metabolism
lmok00650  Butanoate metabolism
lmok00900  Terpenoid backbone biosynthesis
lmok01100  Metabolic pathways
lmok01110  Biosynthesis of secondary metabolites
lmok01120  Microbial metabolism in diverse environments
lmok01130  Biosynthesis of antibiotics
lmok01200  Carbon metabolism
lmok01212  Fatty acid metabolism
lmok02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CQ02_07265
   00630 Glyoxylate and dicarboxylate metabolism
    CQ02_07265
   00640 Propanoate metabolism
    CQ02_07265
   00650 Butanoate metabolism
    CQ02_07265
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CQ02_07265
   00072 Synthesis and degradation of ketone bodies
    CQ02_07265
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CQ02_07265
   00310 Lysine degradation
    CQ02_07265
   00380 Tryptophan metabolism
    CQ02_07265
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CQ02_07265
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CQ02_07265
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CQ02_07265
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmok04147]
    CQ02_07265
Enzymes [BR:lmok01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CQ02_07265
Exosome [BR:lmok04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CQ02_07265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHN32657
UniProt: A0A0B8RAM1
Position
complement(1423574..1424743)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEIDPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAANAQEKNLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDDIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILEKA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaatttggtggtagt
ttgaaagacatcagtgcagtagaccttggcgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgggtggatcaagtgatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtttgtggatctggcttaaaatcggttatgcttggtaggcaa
gcaattcagctaggggaggctgacatcgtagccgttggtgggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagctggcgaagaaatcgatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgagtatcacatgggaattact
gcagaaaatgttgcagagaaattctccgtaaccagagaagaacaagatgaatttgcccat
aactcacaaatgaaggccgcgaatgcacaagaaaaaaacctttttgaagaggaaattatt
cctgtaaagcttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctactttgaaaagcgtattcaaagaaggtggaacggttacagcc
ggcaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaagttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgacattgatttattccatttaaacgaagcttttgcatcgcagtca
gttgcagtggctcgtgatttaaaaattccagaagagaaacttaatatttacggtggagca
attgcactaggccatccaattggagcttctggtgcacgcattattgcctcattgttaaat
gagttaaaacatgaaaataagcacatcggtgtcgcttccttgtgtgttggtggtggtatt
ggtattgcaattatccttgaaaaagcttga

DBGET integrated database retrieval system