KEGG   Listeria monocytogenes L312: LMOL312_1335Help
Entry
LMOL312_1335      CDS       T02247                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lmol  Listeria monocytogenes L312
Pathway
lmol00010  Glycolysis / Gluconeogenesis
lmol00052  Galactose metabolism
lmol00500  Starch and sucrose metabolism
lmol00520  Amino sugar and nucleotide sugar metabolism
lmol00521  Streptomycin biosynthesis
lmol01100  Metabolic pathways
lmol01110  Biosynthesis of secondary metabolites
lmol01120  Microbial metabolism in diverse environments
lmol01130  Biosynthesis of antibiotics
lmol01200  Carbon metabolism
Module
lmol_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmol_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOL312_1335 (glcK)
   00052 Galactose metabolism
    LMOL312_1335 (glcK)
   00500 Starch and sucrose metabolism
    LMOL312_1335 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    LMOL312_1335 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LMOL312_1335 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LMOL312_1335 (glcK)
Enzymes [BR:lmol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LMOL312_1335 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: CBY67413
Position
1349960..1350928
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKEGDIEEKWTIDTNIEEKGAHIVKNIGDSINQKLTDLQL
DNDIFYGIGMGTPGTVNYETGTVKGAYNLGWADEQNVSQDLENITGLKIILDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGIRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDLAKEYTGKSALKDAINNDETITSKLIFELGAEDDALANET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKTYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPSED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcgggacaacagcaaaattagctatttta
acaaaagaaggcgacattgaagaaaaatggacaattgatacaaatattgaagaaaagggc
gcccacattgttaaaaacattggggattctatcaatcaaaaattaacggacttacaactg
gataatgatattttttatggtattggtatgggaactccaggtactgtaaattatgaaaca
ggtactgtaaaaggtgcgtacaacttaggctgggcagatgaacaaaatgttagtcaagat
ttagaaaatattactggtttaaaaatcatattagataatgatgctaatgttgccgctctt
ggtgaacgctggaaaggcgcaggcgaaggtggggctaatgtcgttttcgtaacacttgga
acaggcgttggcggcggaattttcgcagaaggcaaaattttacatggtattcgcggagca
gctggtgaaattgggcatgtaacagtagttcctgagaatggttatgattgtacctgtggc
aaaaaaggctgtttagaaactgtcgcatcagcaacaggaatcgttcgagtagcgaaagat
ttagcgaaagagtatactggtaaatccgcacttaaagatgcaataaataacgatgaaaca
attacttctaaattgatttttgaactaggagcagaagatgatgctttagcaaatgaaaca
attgataaaatttctttctatttggctttagcgctcagtcatattggaaacatgttaaat
ccagagaagattattattggtggtggcgtttcagcagcaggcgatcaattattaacaccg
gttaaaacttattttgagacaatggttttcccagctgttaaagaatccactaaattatct
attgcgacaaaagggaatgacgcagggataattggagctgcatggttagcgctaccaagt
gaagattaa

DBGET integrated database retrieval system