KEGG   Listeria monocytogenes L312: LMOL312_1632Help
Entry
LMOL312_1632      CDS       T02247                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lmol  Listeria monocytogenes L312
Pathway
lmol00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmol01100  Metabolic pathways
lmol01110  Biosynthesis of secondary metabolites
lmol01130  Biosynthesis of antibiotics
lmol01230  Biosynthesis of amino acids
Module
lmol_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmol00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LMOL312_1632 (trpC)
Enzymes [BR:lmol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LMOL312_1632 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: CBY67710
Position
complement(1656138..1656896)
Genome map
AA seq 252 aa AA seqDB search
MTFLEEILAQKAVEVADMPLEKVAEKRKTYSFYEFLKANTSTMQLIAEVKRASPSKGEIN
MGVNPVLQAKSYQAAGAGMISVLTDPVFFKGSIEDLREVAKNVEIPVLCKDFIISEKQLI
RARNAGATVVLLIISALTEEMLIALFEQALALDLEVLVEVHDQKELAVAQKIGAKLIGVN
NRNLHTFEVDIAVSERLASDFSSDACFISESGFRTAEDVARVSQKYNAVLVGEALMREAT
PEAAAKSLKVTR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacatttttagaagaaattttagcgcaaaaagcagtagaagttgcagacatgccctta
gaaaaagtagccgaaaaacggaaaacttattcgttttatgaatttttaaaagcaaatacc
agcacgatgcaacttattgcagaagtaaaacgcgcctctccttctaaaggggaaatcaat
atgggcgtgaatccggttctgcaagccaagtcttatcaagctgcgggtgcaggaatgatt
tctgttttgacagatcctgtttttttcaaaggctcgattgaagatttgcgagaagtagcg
aaaaatgtcgaaattcctgtactatgtaaagattttattattagtgaaaaacaattgatt
cgtgctcgaaatgcgggagcaacggttgtattgctaattatttcggcacttacagaagag
atgctaattgctctgtttgaacaagctctggcgcttgatttggaagtgttagtggaagta
catgaccagaaagaattagctgttgctcaaaaaattggagctaaactcattggtgtgaac
aaccgtaatttgcatacatttgaagtggatattgcagtaagtgaaagactggcgagcgat
ttctcgtcggatgcttgtttcataagtgaatcaggttttcgaacagctgaagatgtggct
cgggttagtcaaaaatataatgcagtacttgttggagaagcgctaatgcgagaagcgact
ccagaagcagcggcgaaaagtttgaaggtgacacgatga

DBGET integrated database retrieval system